DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TFRC and CG9416

Sequence 1:NP_001121620.1 Gene:TFRC HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_001261088.1 Gene:CG9416 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster

Alignment Length:329 Identity:61/330 (18%)
Similarity:125/330 (38%) Gaps:68/330 (21%)


Human   309 YTPGFPSFNHT--------------QFPPSRSSG----LPNIPVQTISRAAAEK-----LFGNME 350
            |....|||:..              ||...|:..    |..|..:.:..||.|:     |...: 
  Fly    34 YLVVIPSFHRMPQLKTLEDERQQPGQFIGERAENTLLRLSKIGPKVVGSAANEQVAVQFLLSEI- 97

Human   351 GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFV--------EPDHYVVVGA 407
            ||...|.:||     :....|:|::...|.|. ..::|::..|:..|        ..:..:::.:
  Fly    98 GDIIDDARTD-----LYDIEKDVQVASGNYLL-WSMVNVYQSIQNVVVKLSPKNATSEAALLINS 156

Human   408 QRDA--WGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGY 470
            ..|:  ...||..:|:...::|::.:    ::.|.....:.|::|....|.:....|:..::..:
  Fly   157 HFDSVPGSSGAGDAGMMCVIMLEVLR----VITKYETPLTYSVVFLFNGAEENPLQGSHAFITQH 217

Human   471 LSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHP---VTGQFLYQDSNWASKV 532
            ..:.:::|  .||||.|..|.......:.|....|::...:|:.||   ..|:.|:|:....|:.
  Fly   218 PWAQNIRA--VINLDSAGSGGREILFQSGPDHPWLMKYYGKNIVHPFASTIGEELFQNGFVPSET 280

Human   533 EKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQF 597
            :...       |..|..||.:.           :..|::.| ....:....|.:.|...::.|:.
  Fly   281 DYRV-------FRDYGHIPGLD-----------MAQTLNGY-VYHTKYDRFNLIPRRTYQLTGEN 326

Human   598 VIKL 601
            ::.|
  Fly   327 ILAL 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TFRCNP_001121620.1 Mediates interaction with SH3BP4. {ECO:0000269|PubMed:16325581} 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 201..377 CDD:239043 20/91 (22%)
M28_TfR 385..610 CDD:193572 39/231 (17%)
Ligand-binding 569..760 6/34 (18%)
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 57/307 (19%)
MFS 423..>624 CDD:304372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.