DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TFRC and CG10051

Sequence 1:NP_001121620.1 Gene:TFRC HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_611414.1 Gene:CG10051 FlyBaseID:FBgn0034437 Length:866 Species:Drosophila melanogaster

Alignment Length:576 Identity:124/577 (21%)
Similarity:185/577 (32%) Gaps:188/577 (33%)


Human   151 SYVPREAGSQKDE-NLALY---VENQFRE------------FKLSKVWRDQHFVKIQVKDSAQNS 199
            :::.||....||| .|.||   |:.|:..            ..||.|     .|||..|.|...:
  Fly    96 NFLLREIQKIKDEARLDLYDIEVDTQYSSGAFHLWGMTISYTNLSNV-----VVKISQKSSDNEN 155

Human   200 VIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGT----KKDFEDLYTPV----NGSIVI 256
            .::|  |......|:.|        ||...|.:|.....|    .:....|..||    ||:...
  Fly   156 YLLV--NSHYDSEVQTP--------AAGDDGVMVVVMLETLRVISRSERTLTHPVVFLFNGAEEA 210

Human   257 VRAGKITF---------AEKVANAESLNAIG--VLI------------YMDQTKFPIVN--AELS 296
            ...|...|         .:.:.|.:|..|.|  ||.            |......|...  || .
  Fly   211 CMLGSHGFITQHKWSKNCKALVNLDSTGAGGREVLFQTGPNHPWLAKYYQASVPHPYAQTLAE-E 274

Human   297 FFGH-----------------------AHLGTGDPYTPGFPSFNHTQFPPSRSSG---------L 329
            .|.|                       |.:..|..|...|.:|.:.::...:|:|         |
  Fly   275 LFQHNFIPSDTDFRIFRDYGGVPGLDMASVMNGYVYHTEFDNFKNVEYGTYQSTGENVLPLIWAL 339

Human   330 PNIPVQTISRAAAEK---LFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFG 391
            .|.| :..:..|.||   ::.:..|     |     ..|..:||.::.:   ||:..:......|
  Fly   340 ANAP-ELDNTTAYEKGHTVYYDFLG-----W-----FMMTYTESVSIAI---NVVVSVAAFICIG 390

Human   392 VIKGFVEPDHYVVVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDM---------------VLKDG 441
            .....:..|:           |..|.|     |::|:.|.:|...               |...|
  Fly   391 TSVYIMTLDN-----------GADAPK-----AVVLRFAIIFLVQAGTLFVACGLTLLVAVFMQG 439

Human   442 FQPSRSIIFASWSAGDFGSVGATEWLE-GYLSSLHL---KAFTYINLDKAVLGTSNFKVSASPLL 502
            ...:.|..:..|.|  ||....|.:.. |.|.:.::   |..|.:.||:.:   :.|..:...||
  Fly   440 VGLAESWYYGKWMA--FGLYFCTLFFAFGILPATYIGFTKRKTNMKLDQTI---ACFMHAQCILL 499

Human   503 YTL-IEKTMQNVK---HPVTGQFLYQDSNWASKVEKLTLDNAAF----------PFLAYSGI--- 550
            ..| |..|:..::   .|:.|.|.|..|.....|.||||..:.|          ||..|:.|   
  Fly   500 ALLCIIMTIMGIRSSYFPMVGIFFYAISVLVQIVLKLTLKKSYFVTVHLLFQVLPFFFYTYICYA 564

Human   551 PAVSFCFCEDTDYPYLGTTMDTYKELIERIPELN---KVARAAAEVAGQFVIKLTH 603
            ..|:|...|..|.|             |..|::.   .:...|...|| |||.:.|
  Fly   565 TLVTFVPMEGRDGP-------------ESSPDIMISVFIIATAINYAG-FVIPIMH 606

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TFRCNP_001121620.1 Mediates interaction with SH3BP4. {ECO:0000269|PubMed:16325581} 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 201..377 CDD:239043 46/244 (19%)
M28_TfR 385..610 CDD:193572 58/259 (22%)
Ligand-binding 569..760 9/39 (23%)
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
CG10051NP_611414.1 M28_Fxna_like 62..369 CDD:193497 62/300 (21%)
MATE_like 361..>604 CDD:298879 64/291 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.