DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFRC and CG11961

DIOPT Version :10

Sequence 1:NP_003225.2 Gene:TFRC / 7037 HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_725876.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster


Alignment Length:276 Identity:57/276 - (20%)
Similarity:104/276 - (37%) Gaps:68/276 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   372 NVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDA--WGPGAAKSGVGTALLLKLAQMF- 433
            |:..::.|::.:|...|        .....|::|.:..|:  .||||...|...|.::::.::. 
  Fly   160 NMYQSIQNIVVKISPKN--------TNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLA 216

Human   434 -SDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVS 497
             ||..||:      .::|....|.:.....:..::..:..:.:.||.  ||||....|.......
  Fly   217 KSDKPLKN------PVVFLFNGAEENPLQASHAFITQHKWAKYCKAL--INLDSCGNGGREILFQ 273

Human   498 ASPLLYTLIEKTMQNVKHP---VTGQFLYQDSNWASKVE-KLTLDNAAFPFLAYSGIPAVSFCFC 558
            :.|....|::...:.:|||   ..|:.|:|.:...|..: ::..|:.:.|.|             
  Fly   274 SGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGL------------- 325

Human   559 EDTDYPYLG-------------------TTMDTYKELIERI---PELNKVARAAA------EVAG 595
             |..|.|.|                   .|.|....|:.:|   ||:...|:.|.      :|.|
  Fly   326 -DMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMG 389

Human   596 QFVI--KLTHDVELNL 609
            .|::  ..|..|.||:
  Fly   390 WFLVFYTETEGVILNV 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFRCNP_003225.2 Mediates interaction with SH3BP4. /evidence=ECO:0000269|PubMed:16325581 1..67
Endocytosis signal. /evidence=ECO:0000269|PubMed:2298808 20..23
Stop-transfer sequence. /evidence=ECO:0000303|PubMed:6090955 58..61
PA_TfR 201..377 CDD:239043 1/4 (25%)
M28_TfR 364..610 CDD:349946 57/276 (21%)
Ligand-binding 569..760 15/52 (29%)
TFR_dimer 637..750 CDD:461238
Cell attachment site, required for binding to transferrin 646..648
CG11961NP_725876.1 M28_Fxna_like 91..395 CDD:349872 53/264 (20%)
MFS <539..>658 CDD:475125
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.