DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TFRC and CG13160

Sequence 1:NP_001121620.1 Gene:TFRC HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_001260918.1 Gene:CG13160 FlyBaseID:FBgn0033720 Length:875 Species:Drosophila melanogaster

Alignment Length:262 Identity:51/263 (19%)
Similarity:97/263 (37%) Gaps:63/263 (24%)


Human   333 PVQTISRAAAE------KLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNVLK------EIK 385
            |.|.::..|.|      :|...:.||..::   .:...::.:|.:.|:    .||:      |::
  Fly    71 PGQFVAERAQEILLQISRLGPRVVGDVDNE---VTVVNLLLAEIEKVR----QVLRDDVYEMEVE 128

Human   386 ILNIFG--VIKGFVEPDH--------------------YVVVGAQRDAWGPGAAKSGVGTALLLK 428
            :....|  :|||..  :|                    |::|.:..|. .||:..:|...|:::.
  Fly   129 VQRASGSYLIKGLT--NHYQGVQNVIVRLSTKSSNSTSYLLVNSHYDT-KPGSPGAGDDAAMVVV 190

Human   429 LAQMFSDMVLKDGFQPSRSIIFASWSA------GDFGSVGATEWLEGYLSSLHLKAFTYINLDKA 487
            :.::.. :|...|......|||....|      |..|.:....|      :.:.||.  :|||.|
  Fly   191 MLEVLR-LVAVSGDPFLHPIIFLFNGAEEQPMQGSHGFITQHRW------AANCKAL--LNLDSA 246

Human   488 VLGTSNFKVSASPLLYTLIEKTMQNVKHP---VTGQFLYQDSNWASKVE-KLTLDNAAFPFLAYS 548
            ..|..:......|....|:|....:..||   .|.:.:::.....|..: ::..|....|.|..:
  Fly   247 GAGGRDLLFQGGPNHPWLMEHYRNSAPHPFATTTAEEMFEAGIIPSDTDFRIFRDFGVVPGLDMA 311

Human   549 GI 550
            |:
  Fly   312 GV 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TFRCNP_001121620.1 Mediates interaction with SH3BP4. {ECO:0000269|PubMed:16325581} 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 201..377 CDD:239043 9/50 (18%)
M28_TfR 385..610 CDD:193572 39/199 (20%)
Ligand-binding 569..760
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
CG13160NP_001260918.1 M28_Fxna_like 71..378 CDD:193497 51/263 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.