DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TFRC and CG30049

Sequence 1:NP_001121620.1 Gene:TFRC HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_725142.3 Gene:CG30049 FlyBaseID:FBgn0050049 Length:878 Species:Drosophila melanogaster

Alignment Length:365 Identity:66/366 (18%)
Similarity:114/366 (31%) Gaps:103/366 (28%)


Human   307 DPYTPGFPSFNHTQFPPSRSSGL--------PNIPVQTISRAA--------AEKLFGNMEGDC-- 353
            :|..||       ||...|:..:        |.:...|.:...        .||:...|.||.  
  Fly    67 EPLKPG-------QFVGERAQKILYELDRIGPKVVGSTANEVTTVAFLLNEVEKIRSEMRGDLFH 124

Human   354 -------PSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDA 411
                   |:......|...:....:||.:.:|....               ....|:::.:..|.
  Fly   125 LEVDVQQPTGSYVVGTMTSIYQGIQNVVVKLSTASS---------------NSSSYLLINSHFDT 174

Human   412 --WGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSA------GDFGSVGATEWLE 468
              ..|||...|....::|::.:..|  :.:..|.  ..|:|....|      ...|.:...:|  
  Fly   175 KPGSPGAGDDGTMVVVMLEVLRQMS--ISESEFM--HPIVFLFNGAEENPLQASHGFITQHKW-- 233

Human   469 GYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVE 533
                :.:.||  .|||:....|..:....:.|....|::...|:.|||..       |..|.::.
  Fly   234 ----APNCKA--VINLEVGGNGGRDILFQSGPNNPWLVKYYKQHSKHPFA-------STLAEEIF 285

Human   534 K---LTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTY--------KELIERIPELNKVA 587
            :   |..|.....|..|..||.:......: .|.| .|..|::        :...|.|..|.:..
  Fly   286 QFGILPSDTDFRIFRDYGNIPGLDIAQFSN-GYVY-HTAFDSFDVVPGRAVQNTGENILSLVRAL 348

Human   588 RAAAEV----------------AGQFVIKLTHDVELNLDY 611
            ..|:|:                .|.|.:..|.:..:.|:|
  Fly   349 SNASELYNTNEHSAGHAVFFDFLGLFFVTYTENTGIILNY 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TFRCNP_001121620.1 Mediates interaction with SH3BP4. {ECO:0000269|PubMed:16325581} 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 201..377 CDD:239043 17/95 (18%)
M28_TfR 385..610 CDD:193572 47/260 (18%)
Ligand-binding 569..760 11/68 (16%)
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
CG30049NP_725142.3 M28_Fxna_like 71..378 CDD:193497 62/350 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.