DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFRC and CG30047

DIOPT Version :10

Sequence 1:NP_003225.2 Gene:TFRC / 7037 HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_725141.1 Gene:CG30047 / 246414 FlyBaseID:FBgn0050047 Length:879 Species:Drosophila melanogaster


Alignment Length:185 Identity:37/185 - (20%)
Similarity:72/185 - (38%) Gaps:40/185 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   361 STCRMVTSESKNVKLTVSNVLKEIKI--------------LNIF-GVIKGFVE-------PDHYV 403
            :|...:..|.:|::..:.:.|.|:::              :|:: ||....|:       ...|:
  Fly   103 TTVAFLEEEVENIRAAMRSDLYELQLDVQHPSGAYMHWQMVNMYQGVTNVVVKISSRSSNSSSYL 167

Human   404 VVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQP-SRSIIFASWSA------GDFGSV 461
            :|.:..|: .|.:..||....:::.:.::...:.:.|  .| ...|:|....|      ...|.:
  Fly   168 LVNSHFDS-KPSSPGSGDDGTMVVVMLEVLRQVAISD--TPFEHPIVFLFNGAEENPLEASHGFI 229

Human   462 GATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHP 516
            ...:| .|...:|       |||:.|..|..:....:.|....||:...||.|||
  Fly   230 TQHKW-AGNCKAL-------INLEVAGSGGRDLLFQSGPNNPWLIKYYYQNAKHP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFRCNP_003225.2 Mediates interaction with SH3BP4. /evidence=ECO:0000269|PubMed:16325581 1..67
Endocytosis signal. /evidence=ECO:0000269|PubMed:2298808 20..23
Stop-transfer sequence. /evidence=ECO:0000303|PubMed:6090955 58..61
PA_TfR 201..377 CDD:239043 3/15 (20%)
M28_TfR 364..610 CDD:349946 36/182 (20%)
Ligand-binding 569..760
TFR_dimer 637..750 CDD:461238
Cell attachment site, required for binding to transferrin 646..648
CG30047NP_725141.1 M28_Fxna_like 72..379 CDD:349872 37/185 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.