DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TFRC and CG30047

Sequence 1:NP_001121620.1 Gene:TFRC HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_725141.1 Gene:CG30047 FlyBaseID:FBgn0050047 Length:879 Species:Drosophila melanogaster

Alignment Length:185 Identity:37/186 (20%)
Similarity:72/186 (39%) Gaps:40/186 (22%)


Human   361 STCRMVTSESKNVKLTVSNVLKEIKI--------------LNIF-GVIKGFVE-------PDHYV 403
            :|...:..|.:|::..:.:.|.|:::              :|:: ||....|:       ...|:
  Fly   103 TTVAFLEEEVENIRAAMRSDLYELQLDVQHPSGAYMHWQMVNMYQGVTNVVVKISSRSSNSSSYL 167

Human   404 VVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQP-SRSIIFASWSA------GDFGSV 461
            :|.:..|: .|.:..||....:::.:.::...:.:.|  .| ...|:|....|      ...|.:
  Fly   168 LVNSHFDS-KPSSPGSGDDGTMVVVMLEVLRQVAISD--TPFEHPIVFLFNGAEENPLEASHGFI 229

Human   462 GATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHP 516
            ...:| .|...:|       |||:.|..|..:....:.|....||:...||.|||
  Fly   230 TQHKW-AGNCKAL-------INLEVAGSGGRDLLFQSGPNNPWLIKYYYQNAKHP 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TFRCNP_001121620.1 Mediates interaction with SH3BP4. {ECO:0000269|PubMed:16325581} 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 201..377 CDD:239043 3/16 (19%)
M28_TfR 385..610 CDD:193572 32/162 (20%)
Ligand-binding 569..760
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
CG30047NP_725141.1 M28_Fxna_like 72..379 CDD:193497 37/186 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.