DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFRC and CG30047

DIOPT Version :9

Sequence 1:NP_003225.2 Gene:TFRC / 7037 HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_725141.1 Gene:CG30047 / 246414 FlyBaseID:FBgn0050047 Length:879 Species:Drosophila melanogaster


Alignment Length:185 Identity:37/185 - (20%)
Similarity:72/185 - (38%) Gaps:40/185 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   361 STCRMVTSESKNVKLTVSNVLKEIKI--------------LNIF-GVIKGFVE-------PDHYV 403
            :|...:..|.:|::..:.:.|.|:::              :|:: ||....|:       ...|:
  Fly   103 TTVAFLEEEVENIRAAMRSDLYELQLDVQHPSGAYMHWQMVNMYQGVTNVVVKISSRSSNSSSYL 167

Human   404 VVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQP-SRSIIFASWSA------GDFGSV 461
            :|.:..|: .|.:..||....:::.:.::...:.:.|  .| ...|:|....|      ...|.:
  Fly   168 LVNSHFDS-KPSSPGSGDDGTMVVVMLEVLRQVAISD--TPFEHPIVFLFNGAEENPLEASHGFI 229

Human   462 GATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHP 516
            ...:| .|...:|       |||:.|..|..:....:.|....||:...||.|||
  Fly   230 TQHKW-AGNCKAL-------INLEVAGSGGRDLLFQSGPNNPWLIKYYYQNAKHP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFRCNP_003225.2 Mediates interaction with SH3BP4. /evidence=ECO:0000269|PubMed:16325581 1..67
Endocytosis signal. /evidence=ECO:0000269|PubMed:2298808 20..23
Stop-transfer sequence. /evidence=ECO:0000303|PubMed:6090955 58..61
PA_TfR 201..377 CDD:239043 3/15 (20%)
M28_TfR 364..610 CDD:349946 36/182 (20%)
Ligand-binding 569..760
TFR_dimer 637..750 CDD:461238
Cell attachment site, required for binding to transferrin 646..648
CG30047NP_725141.1 M28_Fxna_like 72..379 CDD:349872 37/185 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.