DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFRC and CG30043

DIOPT Version :9

Sequence 1:NP_001121620.1 Gene:TFRC / 7037 HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster


Alignment Length:257 Identity:48/257 - (18%)
Similarity:96/257 - (37%) Gaps:64/257 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   361 STCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPD--------HYVVV-----GAQRDAW 412
            :|...:.:|::.::..:.:.|.::: |::.....|:|..|        |.|:|     .:|.:::
  Fly   102 TTVEFLVNETEKIRAEMRSDLYDLE-LDVQSPTGGYVFNDMVNMYQGIHNVIVKLSSKSSQSESY 165

Human   413 ---------GPGAAKSGVGTALLLKLAQMFSDMVLKD-GFQPSRSIIFASWSA------GDFGSV 461
                     .||:..||....:::.:.::...|.:.: .|:  ..|:|....|      ...|.:
  Fly   166 LLLNSHFDSKPGSPGSGDDGTMVVVMMEVLRQMSISEIPFE--HPIVFLFNGAEENPLQASHGFI 228

Human   462 GATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDS 526
            ...:|.|        |...:|||:....|..:....:.|....|::...|:.|||          
  Fly   229 TQHKWAE--------KCKAFINLEVGGSGGRDLLFQSGPNNPWLMKYYRQHAKHP---------- 275

Human   527 NWASKVEKLTLDNAAFP-------FLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIP 581
             :|:.:.:....:...|       |..|..|..:.....|: .|.| .|..|||    |.:|
  Fly   276 -FATTMAEEIFQSGVLPSDSDFRIFRDYGNIAGLDIAQIEN-GYVY-HTAFDTY----ENVP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFRCNP_001121620.1 Mediates interaction with SH3BP4. /evidence=ECO:0000269|PubMed:16325581 1..67
Endocytosis signal. /evidence=ECO:0000269|PubMed:2298808 20..23
Stop-transfer sequence. /evidence=ECO:0000303|PubMed:6090955 58..61
PA_TfR 201..377 CDD:239043 2/15 (13%)
M28_TfR 385..610 CDD:193572 45/233 (19%)
Ligand-binding 569..760 5/13 (38%)
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 48/257 (19%)
PMT_2 493..>634 CDD:304453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.