DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TCP1 and CCT1

Sequence 1:NP_110379.2 Gene:TCP1 HGNCID:11655 Length:556 Species:Homo sapiens
Sequence 2:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster

Alignment Length:555 Identity:407/556 (73%)
Similarity:475/556 (85%) Gaps:2/556 (0%)


Human     1 MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLL 65
            :..|||:.|.|.:|.::|:||||||.||:||||||||||||||||||||||||:||||||||:||
  Fly     4 LASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLL 68

Human    66 EVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVR 130
            ||||||||||.|||.|||:|||||||||||:||||||||||||||||||||:|||||:|||||.:
  Fly    69 EVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACK 133

Human   131 YINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSV 195
            ||:|:|....||||||.|||.|||||||||||.:.:||:.|||||..::|.||.|||..|.:.::
  Fly   134 YISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAI 198

Human   196 NILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKL 260
            |:|||||:|..||:||.||||||.:.||.|||:|||||||||||||||||||:||||:|.||:||
  Fly   199 NVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKL 263

Human   261 DQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGA 325
            :.||.||.|||||||..||.||.||:|.:||:||:|:||||||||||||||.|.|||.||||:||
  Fly   264 EAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGA 328

Human   326 TILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMER 390
            ..:::|.|::|||:|:|:|:|:|.||.|||||||||||||.||||.:|||||||.|||.||||||
  Fly   329 AFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMER 393

Human   391 SLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVN 455
            |:||||||||||||||.||.|||.|||||||||||:|||:.|||||||||||:||||||.||:||
  Fly   394 SVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVN 458

Human   456 AAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEA 520
            ||:|:||||||||::||.:|..|||.:|||.||||..|..||||:|||.||.:.|:|||||||||
  Fly   459 AAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEA 523

Human   521 AITILRIDDLIKLHPESKDDKHGSYEDAVHSGALN 555
            |||||||||:|||:||.|..|  ||.||..:|.|:
  Fly   524 AITILRIDDMIKLNPEDKSGK--SYADACAAGELD 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TCP1NP_110379.2 TCP1_alpha 9..535 CDD:239451 394/526 (75%)
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 399/535 (75%)
TCP1_alpha 12..538 CDD:239451 394/526 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158995890
eggNOG 1 0.900 E1_COG0459
Hieranoid 1 1.000
Homologene 1 1.000 H5656
Inparanoid 1 1.050 801 1.000 Inparanoid score I495
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D205390at33208
OrthoFinder 1 1.000 FOG0004421
OrthoInspector 1 1.000 T1072570
orthoMCL 1 0.900 OOG5_127998
Panther 1 1.100 LDO PTHR11353
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1484
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.