DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TCF12 and Fer3

DIOPT Version :9

Sequence 1:XP_011520261.1 Gene:TCF12 / 6938 HGNCID:11623 Length:718 Species:Homo sapiens
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:180 Identity:40/180 - (22%)
Similarity:76/180 - (42%) Gaps:43/180 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   149 DLGLGSPAQLSS--SGKPGTAYYSFSATSSRRRPLHDSAALDPLQAKKVRKVPPGLPSSVYAPSP 211
            ||.|...:|::.  ..:|.|...:..::||.::.....|::...:|..:|:     ...::..:.
  Fly    45 DLSLWQRSQVTPLVPQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRE-----RRRMFNLNE 104

Human   212 NSDDFNRESPSYPSPKP----PTSMFASTF--FMQDGTHNSSDLWSSSNGMSQPGFGGILGT-ST 269
            ..|...|:.|::...|.    .|...|.|:  ||       ::|.|              || |.
  Fly   105 AFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFM-------AELLS--------------GTPSN 148

Human   270 SHMSQSSSYGNLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRGSTSSSPY 319
            ||.|:|..||:::.|.:.  ||.::.|..::    |.:::.|  ..:|||
  Fly   149 SHKSRSDVYGSMNGHHQA--PPPAIHPHHLH----PAAAYQR--DFASPY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TCF12XP_011520261.1 CytochromB561_N 287..>460 CDD:286826 8/33 (24%)
HLH 619..672 CDD:197674
Fer3NP_524322.1 HLH 87..135 CDD:278439 9/52 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.