DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp8a2 and CG33298

Sequence 1:XP_003751540.1 Gene:Atp8a2 RGDID:1594597 Length:1188 Species:Rattus norvegicus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1304 Identity:418/1305 (32%)
Similarity:632/1305 (48%) Gaps:262/1305 (20%)


  Rat    46 SVGDQLEAPA-RIIYLN---------QSHLN-KFCDNRISTAKYSVLTFLPRFLYEQIRRAANAF 99
            :.||:.|..: |.:..|         :.|.| :|..|:|.|.||::|:|:|:.|.||..|.||.:
  Fly   217 NTGDKFEERSYRTVVPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLY 281

  Rat   100 FLFIALLQQIPDVSPTGRYTTLVPLVIILTIAGIKEIVEDFKRHKADNAVNKKKTIVLRNG---M 161
            |:||.||..:|::|..|:...::|::.:|.:..:|::.||.:|..:|..:| ..|..:.:|   .
  Fly   282 FIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRIN-NTTCRVYDGETER 345

  Rat   162 WHTIMWKEVAVGDIVKVLNGQYLPADMVLFSSSEPQGMCYVETANLDGETNLKIRQGLSHTADMQ 226
            :..:.|:|:.|||||.:.|.:.:|||::|..:|:|||:||::|.:||||||||.|:.:....:||
  Fly   346 YKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQ 410

  Rat   227 TREVLMKLSGRIECEGPNRHLYDFTGTL-HLDGKSSVALGPDQILLRGTQLRNTQWVFGVVVYTG 290
            :..|..|...|:|.:.|...||.|.|.| |..|: .|.:..:.:|||.::|:||.::.|:|||.|
  Fly   411 SIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGE-RVPISTECLLLRESRLKNTDYIEGIVVYAG 474

  Rat   291 HDTKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSVGALFWNGS--HGGKSWYIKKMD 353
            |:||.|.|::....|||.||:..|:.::....|||::.:|.::|...|..|  |....:......
  Fly   475 HETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTHFPVPYLPPNKL 539

  Rat   354 TTSDNFGYNLLTFIILYNNLIPISLLVTLEVVKYTQALFINWDTDMYYIENDTPAMARTSNLNEE 418
            |.:....:...|:|::...:||:||.||:|:.|..|...|:.:.|::..|.:.....|..|:.||
  Fly   540 TANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEE 604

  Rat   419 LGQVKYLFSDKTGTLTCNIMNFKKCSIAGVTYGHFP-ELAREQSSDDFCRMTSCPSDSCDFNDPR 482
            |||::::|:|||||||.|.|.|::|.:.|..|.|.| ||.:..|..........|:|:.: :|..
  Fly   605 LGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAPPLIPNDNLN-SDMA 668

  Rat   483 LLKNIEDEHPTAPCIQEFLTLLAVCHTVV----PEKD---------------------------- 515
            .|.......|.|..|||||.:||:|:||:    |.:|                            
  Fly   669 QLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQK 733

  Rat   516 ----------------------------GDEII-------------------------------- 520
                                        .|..|                                
  Fly   734 LLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPI 798

  Rat   521 ----------------------------------------------------------------- 520
                                                                             
  Fly   799 SSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKT 863

  Rat   521 ------------YQASSPDEAALVKGAKKLGFVFTGRTPYSVIIE--AMGQEQTFGILNVLEFSS 571
                        |:|.||||.|||..|.........|:|..:::.  ..|..:.:.||.||.|.|
  Fly   864 GTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDS 928

  Rat   572 DRKRMSVIVR-MPSGQLRLYCKGADNVIFERL------SKDSKYMEETLCHLEYFATEGLRTLCV 629
            .||.||::|| :.|.::.||.||||:.|...|      |.:....|:|...|:.:|.||||.|.:
  Fly   929 SRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRILVM 993

  Rat   630 AYADLSENEYEEWLKVYQEASIILKDRAQRLEECYEIIEKNLLLLGATAIEDRLQAGVPETIATL 694
            |...|:..:|.:|...:||..:.|::|.:||.:.:..:|.||.|||||.||||||.|||||||:|
  Fly   994 AKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASL 1058

  Rat   695 LKAEIKIWVLTGDKQETAINIGYSCRLVSQNMALILLKEDSLDATRAAITQHCTDLGN-----LL 754
            |.|.|.:|||||||.||||||.||.:|.:|.|.||.|...|.||...||..:.||:.|     .|
  Fly  1059 LSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYLTDMENDKTTSTL 1123

  Rat   755 G-----KENDVALIIDGHTLKYAL--SFEVRRSFLDLALSCKAVICCRVSPLQKSEIVDVVKKRV 812
            |     ::...||::||.||.:.|  ..::...||.|:..|.:|:|||.:||||:.:|.|||:.:
  Fly  1124 GYGQSLRKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEEL 1188

  Rat   813 KAITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTK 877
            ...|||||||||||.|||.|.|||||||.|||||...:|:.:.:|.|||:|||.||.|.|:|:::
  Fly  1189 NLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSR 1253

  Rat   878 CILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESMLR 942
            .|||.||||.....:..|:....|||||::.::..:.|||:|||:|||..:|::::...::.:|:
  Fly  1254 MILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLK 1318

  Rat   943 FPQLYKITQNAEGFNTKVFWGHCINALVHSLILFWVPMKA-LEHDTPLTSGHATDYLFVGNIVYT 1006
            .|.|||..:....:....||...::||..||::|:|.:.| .|.|             ||...:.
  Fly  1319 NPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAESD-------------VGIWEFG 1370

  Rat  1007 YVVVTVCLKAGL-----ETTAWTKFSHLAV---WGSMLIWLVF--------FGVYSTFWPTIPIA 1055
            ..:...||.|.|     |..:||....|::   .||..::.:.        |||.|::|...   
  Fly  1371 TTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIF--- 1432

  Rat  1056 PDMKGQATMVLSSAHFWLGLLL-----VPTACLIEDVAWRAAKHTCKKTLLEEVQELETKSRVMG 1115
                    :..:||..||.::|     |....|:..|..........|.:|:..:|     |..|
  Fly  1433 --------VCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVILQSKRE-----RSRG 1484

  Rat  1116 KAML 1119
            :|:|
  Fly  1485 EALL 1488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp8a2XP_003751540.1 PhoLip_ATPase_N 57..119 CDD:292826 26/72 (36%)
ATPase-Plipid 68..1106 CDD:273734 406/1257 (32%)
E1-E2_ATPase 125..>342 CDD:278548 81/223 (36%)
Cation_ATPase 506..604 CDD:289987 42/276 (15%)
HAD_like <816..845 CDD:304363 25/29 (86%)
PhoLip_ATPase_C 848..1099 CDD:292829 78/273 (29%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 23/50 (46%)
ATPase-Plipid 250..1473 CDD:273734 405/1250 (32%)
E1-E2_ATPase 302..>394 CDD:278548 32/93 (34%)
Cation_ATPase <880..965 CDD:289987 32/85 (38%)
HAD_like <1177..1240 CDD:304363 38/63 (60%)
PhoLip_ATPase_C 1223..1468 CDD:292829 77/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.