DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp8b5p and CG33298

Sequence 1:XP_017449211.1 Gene:Atp8b5p RGDID:1587460 Length:1154 Species:Rattus norvegicus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1281 Identity:401/1282 (31%)
Similarity:636/1282 (50%) Gaps:262/1282 (20%)


  Rat    26 EYPDNSIKTSKYSFFNFLPVNLFEQFQRLANAYFLILLFLQLIPQISSLAWYTTVIPLIVVLSIT 90
            ::..|.|:|:||:..:|:|.||.|||.|:||.||:.::.|..:|:||:......:||::.||.:|
  Fly   249 QFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVT 313

  Rat    91 GVKDAIDDVKRHQSDQQVNNRSVLILVNG---RIEENKWRNVQVGDIIKLENDHPVTADVLLLSS 152
            .|||..:|.:|..||:::||.:..: .:|   |.::.||:.::||||:.|.|:..|.||:|||.:
  Fly   314 AVKDLFEDRRRRASDKRINNTTCRV-YDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRT 377

  Rat   153 SEPYGLTYIETADLDGETNLKVKQAVSATSDMEDNLELLSAFNGEVRCEPPNNKLDRFSGTLSY- 216
            |:|.|:.||:|.|||||||||.::.|....:|: ::.:.|.|...|..:.|..||.||.|.|.: 
  Fly   378 SDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQ-SIFVPSKFVSRVEADAPTTKLYRFHGALIHP 441

  Rat   217 LGDTYFLDYERLLLRGCIIRNTDWCYGLVVYTGPDTKLMQNSGRSTFKRTHIDHLMNVLVLWIFM 281
            .|:...:..|.||||...::|||:..|:|||.|.:||.|.|:....:||:.::..||:.|:|..:
  Fly   442 TGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVI 506

  Rat   282 LLGGMCFLLSIGHGIWESNRGYHFQAFLPWERYITSSAASSALAFWSYFIVLNTMVPISLYVSVE 346
            :|..:|.:.:||..:|.|:..:....:||..: :|::..|..: ||:|.::|..|:|:||||::|
  Fly   507 ILLILCVVGAIGCRMWLSSFTHFPVPYLPPNK-LTANMESMWI-FWTYIVILQVMIPLSLYVTIE 569

  Rat   347 IIRLGNSYYINWDRKMFYAPKNTPAQARTTTLNEELGQVEYVFSDKTGTLTENVMIFNKCSINGK 411
            :.::...::|:.:..:|.|..|...:.|...:.|||||::::|:|||||||||.|||.:|.:||.
  Fly   570 LCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGS 634

  Rat   412 TYGYS-------YDENG-QCVPKSPSNKVDFSYNHLADPKFSFYDKTLVEAVKSEDPLVYLFFLC 468
            .|.:.       |.:.| ...|..|::.::.....|....:          :......:..|.:.
  Fly   635 DYNHPPSELEKIYSKPGAPAPPLIPNDNLNSDMAQLTQGTY----------LTPHAQRIQEFLVV 689

  Rat   469 LSLCHTVM--------------------------------------------------------- 476
            |::|:||:                                                         
  Fly   690 LAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQ 754

  Rat   477 -----------------------------------------------------SEEK-------- 480
                                                                 ||.:        
  Fly   755 PQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKN 819

  Rat   481 --------------------------------------------------VEGELVYQAQSPDEG 495
                                                              .:|..:|:|:||||.
  Fly   820 KSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDEL 884

  Rat   496 ALVTASRNFGFVFHSRTPETITV-IEM-GRVRVYRLLAILDFSNERKRMSVIV-QTPEDRVMLFC 557
            |||.|:.::.....:|:|..|.| :.| |..|.|.:|.:|.|.:.||.||::| |.....::|:.
  Fly   885 ALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYT 949

  Rat   558 KGADTIIYELLHPSCA------ALSDVTMDQLDDFASEGLRTLMVAYRELDKAFFQTWIKKHGEA 616
            ||||:.|..:|.| |:      .|.:.|...||.:|.||||.|::|.|.|:.|.:..|..:|.|.
  Fly   950 KGADSSIMPVLVP-CSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEI 1013

  Rat   617 WLTLENREKKLALVYEEIERDLVLLGATAIEDKLQSGVPETIVTLNKAKIKIWVLTGDKQETAVN 681
            .::|||||::|...:.::|.:|.|||||.|||:||.||||||.:|..|.|.:|||||||.|||:|
  Fly  1014 EMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAIN 1078

  Rat   682 IAYSCRIFKDEMDAVFMVEGTDRETVLEELRTARKKMKPESLLESDPINIYLARKSKMPFKAVDE 746
            ||||.::|..:|:.:.:              |||.:...|:     .||.||.....      |:
  Fly  1079 IAYSAKLFTQQMELIRL--------------TARSRDAAET-----AINFYLTDMEN------DK 1118

  Rat   747 VPNG-SYG---------LVISGCSLAYALESNTEFEL--LRTACMCKGVVCCRMTPLQKAQVVDL 799
            ..:. .||         ||:.|.:|.:.|:..::..|  ||.:..|..|:|||.||||||.:|.:
  Fly  1119 TTSTLGYGQSLRKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKV 1183

  Rat   800 VKRYKKVVTLAIGDGANDIGMIKAAHIGVGISGQEGMQATLSSDFSFCQFRYLQRLLLVHGRWSY 864
            ||....:.||||||||||:.||:.|.:||||||||||||.:::||:..:||||:||||.||.|.|
  Fly  1184 VKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCY 1248

  Rat   865 NRMCKFLSYFFYKNFAFTLVHFWYAFFNGFSAQTVYDIWFITFYNLIYTSLPILGLSLFEKDVNE 929
            :|:.:.:.||||||.||..:.|||..:.|||.|.:.|..::..||||:||||.|.:.:::|.|.|
  Fly  1249 DRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAE 1313

  Rat   930 TWSLCYPELYEPGQHNLYFNKKEFIKCLLHGIYSSFVLFFVPMGTVFNSERSDGKDISDFQSFSL 994
            ...|..|.||:.|:..:.:...:|...||..:|.|.|:|||.:.....|      |:..:: |..
  Fly  1314 DLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAES------DVGIWE-FGT 1371

  Rat   995 LVQTTLIWVMTMQIALSTTYWTMINHAFTWGSLGLYFCILFLLCSDGLCLMFPSVFNFLGVARN- 1058
            .:..:.::...:..|:....||:::......|||.::  ||.:..|.:|:      |..||..: 
  Fly  1372 TITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFY--LFAIVYDSVCM------NCFGVRSSY 1428

  Rat  1059 -----GLNQPQMWLCLVLSSVLCLIPLMGYNFLKPILWPINVDKVL 1099
                 .......||.::||:|:.::|.:....::..|.|.:..||:
  Fly  1429 WVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVI 1474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp8b5pXP_017449211.1 None
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 21/50 (42%)
ATPase-Plipid 250..1473 CDD:273734 400/1278 (31%)
E1-E2_ATPase 302..>394 CDD:278548 40/93 (43%)
Cation_ATPase <880..965 CDD:289987 34/86 (40%)
HAD_like <1177..1240 CDD:304363 38/63 (60%)
PhoLip_ATPase_C 1223..1468 CDD:292829 81/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.