DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TBX5 and byn

Sequence 1:XP_016875401.1 Gene:TBX5 HGNCID:11604 Length:534 Species:Homo sapiens
Sequence 2:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster

Alignment Length:507 Identity:162/508 (32%)
Similarity:231/508 (45%) Gaps:98/508 (19%)


Human    70 IKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFAD 134
            :::.|.:|||||:|..:..|||:||.||||||..|:..:||:|...|.:|::.|..|.||:|:.:
  Fly    87 LRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFVQIDSHRWKYVN 151

Human   135 NKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRL 199
            .:|...||||......:||||:||..|||||::.:||.|:||||. .:..|.|:|||:|||:||:
  Fly   152 GEWVPGGKAEVPPSNPIYVHPESPNFGAHWMKEPISFAKVKLTNK-TNGNGQIMLNSLHKYEPRV 215

Human   200 HIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMS 264
            |:|:.      ||:.....|:.||||.|||||:|||.::|.|||:.|||||.|            
  Fly   216 HLVRV------GSEQRHVVTYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKAF------------ 262

Human   265 RMQSKEYP------------VVPRST------------VRQKVASNHS-----PFSSESRALSTS 300
             :.:||.|            ::|..|            ....:|.:|.     |..|.:.::..|
  Fly   263 -LDAKERPDTLYPHDTHYGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVSSAESVGPS 326

Human   301 SNLGSQYQCEN-GVSGPSQDLLPP-PNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETS- 362
            |. ||   |:. |.|..|:.:.|. ..||..|:..|. ...........||:..|...|...|| 
  Fly   327 SG-GS---CDRYGRSLSSRSVAPTRTTPYSRPRVVSG-SGSNGSAGNASSTSPQPPSAPQTPTSL 386

Human   363 PSEEDSFYRSSYPQQQGLGASYRTESAQRQACM---YASS------APPSEPVPSLEDISCNTWP 418
            .|.......:|.....|.|..    ||....|.   ||.|      |.|:..|.|..    ::|.
  Fly   387 HSTSTGSVSTSVSSSSGGGIG----SAPSTGCFSSSYAQSGFMSVDASPTASVFSYP----SSWQ 443

Human   419 SMPSYSSCT-VTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEG----MFQHQTSVA 478
            |..:|.:.| |....||:....::.|:|.:..|         .:|||.....    ...|.|..:
  Fly   444 SNGNYWNATSVPGPMPMNVCSGRNISSHNSPSP---------TNGSPSYTTSSPSYTIHHLTPHS 499

Human   479 HQPVVRQC---GPQTGL-QSPGTLQPPEFLY---SHGV--PRTLSP-HQYHS 520
            ||..:.|.   |...|: ...||...|:..|   :|.|  |...|| ||.::
  Fly   500 HQYNMAQTDIYGTGVGVGGGAGTTGSPQAAYGAAAHQVYHPTPTSPTHQLYT 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TBX5XP_016875401.1 TBOX 69..257 CDD:238106 89/187 (48%)
bynNP_524031.2 TBOX 86..268 CDD:238106 91/201 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.