DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TBX2 and byn

Sequence 1:NP_005985.3 Gene:TBX2 HGNCID:11597 Length:712 Species:Homo sapiens
Sequence 2:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster

Alignment Length:702 Identity:196/703 (28%)
Similarity:276/703 (39%) Gaps:170/703 (24%)


Human    56 GLAGAAAAAAAAAAAAEAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHK 120
            ||.|.||.:...|:.:..|.|....|...|             :|::.:.:::|:.:|||.:|..
  Fly    51 GLGGVAAVSGGGASVSGNGGHRVVGGAGSP-------------NELDRNLRISLDDRELWLRFQN 102

Human   121 LGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKR 185
            |..||::||:||||||..|:..||||..|.|.:|::.|..|..|:|:.|..|:..|||:......
  Fly   103 LTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFVQIDSHRWKYVNGEWVPGGKAEVPPSNP 167

Human   186 MYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTF 250
            :|:||:||..|..||.:|::|.|:||||. ::.:|..:|||:|||:||.|:||..       |..
  Fly   168 IYVHPESPNFGAHWMKEPISFAKVKLTNK-TNGNGQIMLNSLHKYEPRVHLVRVG-------SEQ 224

Human   251 R---TYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLPSLRLYEEHCK 312
            |   ||.||||.|||||||||:::|.|||..|||||.|.|.     ::|.....|    ::.|  
  Fly   225 RHVVTYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKAFLDA-----KERPDTLYP----HDTH-- 278

Human   313 PERDGAESDASSCDPPPAREPPTSPG-AAPSPLRLHRARAEEKSCAADSDPEPERLSEERAGAPL 376
                     .....|||......:.. |||.||.:.::.....||.:.|..|....|...:....
  Fly   279 ---------YGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVSSAESVGPSSGGSCDRY 334

Human   377 GRSPAPDSASPTRLTEPERARERRSPERGKEPAESGGDGPFG-LRSLEKERAEARRKDEGRKEAA 440
            |||.:..|.:|||.|...|.|         ..:.||.:|..| ..|...:...|.:........:
  Fly   335 GRSLSSRSVAPTRTTPYSRPR---------VVSGSGSNGSAGNASSTSPQPPSAPQTPTSLHSTS 390

Human   441 EGKEQGLAPLVVQTDSASPLGAGHLPGLAFSSHLHGQQFF------------------------- 480
            .|.      :.....|:|..|.|..|.....|..:.|..|                         
  Fly   391 TGS------VSTSVSSSSGGGIGSAPSTGCFSSSYAQSGFMSVDASPTASVFSYPSSWQSNGNYW 449

Human   481 ------GPLG----AGQPLFLH---------PGQFTMGPGAFSAMGMGHLL----------ASVA 516
                  ||:.    :|:.:..|         |...|..|    :..:.||.          ..:.
  Fly   450 NATSVPGPMPMNVCSGRNISSHNSPSPTNGSPSYTTSSP----SYTIHHLTPHSHQYNMAQTDIY 510

Human   517 GGGNGGGGGPGTAAGLDAGGLGPAASAASTAAPFPFHLSQHMLASQGIPMPTFGGLFPYPYTYMA 581
            |.|.|.|||.||.        |...:|...||...:|           |.||    .|....|..
  Fly   511 GTGVGVGGGAGTT--------GSPQAAYGAAAHQVYH-----------PTPT----SPTHQLYTN 552

Human   582 AAAAAASALPATSAA------------AAAAAAAGSLSRSPF-LGSARPRLRFSPYQIPVTI--- 630
            |...|.|||..:::.            ..||||.......|. :|.|...|  .|..:..|:   
  Fly   553 AVLNAPSALSYSASGWHNGSGAEYGLYQNAAAAYYQPEYIPLEIGYATHPL--EPVDVSKTLDDP 615

Human   631 -----PPST---SLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGA 674
                 .||.   |::|...||...|::.....|.|.|.....|  |....||
  Fly   616 QAAMYKPSDEQGSVITLECASSSLKSSHDIKIESSSLEHAGER--GTVGGGA 665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TBX2NP_005985.3 T-box 107..287 CDD:307177 87/183 (48%)
Herpes_ICP4_C 300..>467 CDD:332854 37/169 (22%)
TBX 305..383 CDD:315301 17/79 (22%)
Repression domain 1 (RD1) 518..601 24/95 (25%)
bynNP_524031.2 TBOX 86..268 CDD:238106 88/195 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.