DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Elovl5 and CG31523

Sequence 1:NP_599016.2 Gene:Elovl5 MGIID:1916051 Length:299 Species:Mus musculus
Sequence 2:NP_001262255.1 Gene:CG31523 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster

Alignment Length:268 Identity:106/269 (39%)
Similarity:152/269 (57%) Gaps:10/269 (4%)


Mouse    20 DTRVKGWFLLDNYIPTFVCSVIYLLI-VWLGPKYMKNRQPFSCRGILQLYNLGLTLLSLYMFYEL 83
            |.||..:|||.:.:||....:.|... ..|||:.|..|:|...|.:|.:||...|:.|.::|||.
  Fly    21 DPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEY 85

Mouse    84 VTGVWEGKYNFFCQGT-RSAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHH 147
            :...|.|.|:..||.. .|.....|:::.:.||||.||..||.||.||||||.|..::.|||.||
  Fly    86 LMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHH 150

Mouse   148 ATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSI-PSMRPYLWWKKYITQGQLVQFV 211
            ..|....|..:.:.|.|||.|.|.||||:|::||.||.:::: |..:.|:|||||:|..|:||||
  Fly   151 GCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFV 215

Mouse   212 LTIIQTTCGVFWPCSFPLGWLFFQIG-YMISLIALFTNFYIQTYNKKGASRRKDHLK--GHQNGS 273
            .........:|..|.:|.|::.: || :.:..:.||::||...| ...|.||:..:|  |:.|||
  Fly   216 AIFTHQFQLLFRECDYPKGFMVW-IGLHGVMFLFLFSDFYKAKY-LNAARRRRQAVKANGYANGS 278

Mouse   274 VAAVNGHT 281
              |.|||:
  Fly   279 --ASNGHS 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Elovl5NP_599016.2 ELO 27..261 CDD:279492 92/238 (39%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 93/239 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094172at2759
OrthoFinder 1 1.000 FOG0000111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.