DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: STAU1 and loqs

Sequence 1:NP_001309861.1 Gene:STAU1 HGNCID:11370 Length:583 Species:Homo sapiens
Sequence 2:NP_609646.1 Gene:loqs FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster

Alignment Length:591 Identity:128/592 (22%)
Similarity:199/592 (34%) Gaps:187/592 (32%)


Human    17 GSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALC 81
            ||.:..:.|:|..||..:.|:            |:|..                           
  Fly     8 GSSLPQQLQNLHIQPQQASPN------------PVQTG--------------------------- 33

Human    82 MKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPL------LYQVELSVGGQQFNG 140
                    :.|...|:.:....|.|...|:       |....||      |.:.::|....|.:.
  Fly    34 --------FAPRRHYNNLVGLGNGNAVSGS-------PVKGAPLGQRHVKLKKEKISAQVAQLSQ 83

Human   141 KGKTRQAAKHDAAAKALRILQNE--------PLPERLEVNGRESEEENLNKSEISQVFEIALKRN 197
            .|:.:.:...|.|......||..        |..|.|:............|:.:|.:.|:..:|.
  Fly    84 PGQLQLSDVGDPALAGGSGLQGGVGLMGVILPSDEALKFVSETDANGLAMKTPVSILQELLSRRG 148

Human   198 LPVNFESFPLKQVARESGPPHMKNFVTKVSVGE----FVGEGEGKSKKISKKNAAIAVLEEL--K 256
            :...:|   |.|:   .|..|...|..:||..:    |...|.|:|||.:|..||.|::::|  .
  Fly   149 ITPGYE---LVQI---EGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGA 207

Human   257 KLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGI---------------NPISRLAQIQQAKKE 306
            :||..|: ....|.:...|       .:...|.|.               |||..|.::...::.
  Fly   208 QLPESPS-SSAGPSVTGLT-------VAGSGGDGNANATGGGDASDKTVGNPIGWLQEMCMQRRW 264

Human   307 KEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQPTKPA 371
            ..|.|...||.|||..|.|.:...:.|:...|.|.:||:|||.||..|...|             
  Fly   265 PPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRMWMRL------------- 316

Human   372 LKSEEKTPIKKPGDGRKVTFFEPG--SGDENGTSNKEDEFR---MPYLSHQQLPAGILPMVPEVA 431
                ::|||    |..|::....|  .|:...:.|...|.:   :|.|:.|              
  Fly   317 ----QETPI----DSGKISDSICGELEGEPRSSENYYGELKDISVPTLTTQ-------------- 359

Human   432 QAVGVSQGHHT-KDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRP 495
            .:..|||.|.| |:.|               .::||     ...:|.||||              
  Fly   360 HSNKVSQFHKTLKNAT---------------GKKLL-----KLQKTCLKNN-------------- 390

Human   496 SEQLDYLSRV------QGFQVEYKDF-PKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAAL 553
              ::||:..:      ..|:|.|.|. .|....:|..|:..|:.|..:.||.|.........||.
  Fly   391 --KIDYIKLLGEIATENQFEVTYVDIEEKTFSGQFQCLVQLSTLPVGVCHGSGPTAADAQRHAAQ 453

Human   554 NILKLL 559
            |.|:.|
  Fly   454 NALEYL 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
STAU1NP_001309861.1 DSRM 186..256 CDD:214634 22/76 (29%)
DSRM 292..358 CDD:238007 24/66 (36%)
Staufen_C 454..563 CDD:293091 26/114 (23%)
loqsNP_609646.1 DSRM 136..204 CDD:214634 21/74 (28%)
DSRM 250..316 CDD:238007 24/66 (36%)
DSRM 394..460 CDD:214634 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121669183
eggNOG 1 0.900 E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.