DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SSTR1 and AstC-R1

Sequence 1:NP_001040.1 Gene:SSTR1 HGNCID:11330 Length:391 Species:Homo sapiens
Sequence 2:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster

Alignment Length:351 Identity:127/352 (36%)
Similarity:206/352 (59%) Gaps:27/352 (8%)


Human    64 IYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGAL 128
            :|..||::||.||::||||:||::||:|.|||||||||:|||..::.:|||:.:..:..|.||..
  Fly    83 LYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMRICSWRFGEF 147

Human   129 LCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIV 193
            :|:..:...::..|||...|.::|.|||:||.|||.:.|||...:||||:...|..|.:::||::
  Fly   148 MCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVI 212

Human   194 VFSRTAANSDG-TVACNMLMPEPAQRWL-VGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALK 256
            :::.|....|| ..:||::.|:..::.. ..|:||||.:||..|:..|...|.|:|.|:|.|..|
  Fly   213 LYASTVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPK 277

Human   257 AGW--QQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVI-------LG 312
            .|.  ::::|:.||:|.:|:.|:.|:::||:|.::.|:..:.:......:|:|.::       |.
  Fly   278 PGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRLEILIFLLLGALV 342

Human   313 YANSCANPILYGFLSDNFKRS-FQRILCLSWMDNAAE---EPVDYYATALKSRAYS--------- 364
            |:||..|||||.|||:||::| |:...|::..|..|:   ||..:.....|.|..|         
  Fly   343 YSNSAVNPILYAFLSENFRKSFFKAFTCMNKQDINAQLQLEPSVFTKQGSKKRGGSKRLLTSNPQ 407

Human   365 VEDFQPENLESGGVFRNGTCTSRITT 390
            :....|.|   .|...:.|.||..||
  Fly   408 IPPLLPLN---AGNNNSSTTTSSTTT 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SSTR1NP_001040.1 7tmA_SSTR1 59..334 CDD:320636 110/282 (39%)
TM helix 1 60..86 CDD:320636 13/22 (59%)
TM helix 2 93..119 CDD:320636 15/26 (58%)
TM helix 3 130..160 CDD:320636 11/30 (37%)
TM helix 4 172..194 CDD:320636 8/22 (36%)
TM helix 5 220..249 CDD:320636 12/30 (40%)
TM helix 6 264..294 CDD:320636 11/30 (37%)
TM helix 7 302..327 CDD:320636 13/32 (41%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 109/280 (39%)
7tm_1 94..353 CDD:278431 98/259 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BCR0
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 261 1.000 Inparanoid score I3056
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000204
OrthoInspector 1 1.000 T130056
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3938
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.080

Return to query results.
Submit another query.