DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SRY and Sox100B

Sequence 1:NP_003131.1 Gene:SRY HGNCID:11311 Length:204 Species:Homo sapiens
Sequence 2:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster

Alignment Length:88 Identity:42/89 (47%)
Similarity:67/89 (75%) Gaps:1/89 (1%)


Human    57 QDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHR 121
            ::.:|||||||:||::..||.|:.:.|.::|||:||.||..||.|.:::|.||.:.|:||:..|:
  Fly    74 KEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHK 138

Human   122 EKYPNYKYRPRR-KAKMLPKNCS 143
            :::|:|||:||| ||::||...|
  Fly   139 QEHPDYKYQPRRKKARVLPSQQS 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SRYNP_003131.1 Sufficient for interaction with KPNB1 59..136 39/78 (50%)
SOX-TCF_HMG-box 59..130 CDD:238684 34/71 (48%)
Required for nuclear localization 61..77 11/16 (69%)
Sufficient for interaction with EP300. {ECO:0000269|PubMed:15297880} 107..139 16/33 (48%)
Required for nuclear localization 130..136 5/7 (71%)
Necessary for interaction with ZNF208 isoform KRAB-O 138..155 3/7 (43%)
Necessary for interaction with SLC9A3R2. {ECO:0000269|PubMed:9054412} 198..204
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 33/70 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61695746
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.