DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp8b3 and CG33298

Sequence 1:NP_080370.2 Gene:Atp8b3 MGIID:1914581 Length:1335 Species:Mus musculus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1347 Identity:402/1348 (30%)
Similarity:634/1348 (47%) Gaps:293/1348 (22%)


Mouse     9 NLEDKDTEFTWEVKANDRTYHKQFKKKGFLCWRQKKYKSNAIHTAKYNIFSFLPLNLYEQFHRMS 73
            |..||..|.::.....:.|...:..|:..   ...::..|.|.|.||.:.||:|.||.|||||::
  Fly   217 NTGDKFEERSYRTVVPNHTVPPKTPKRDH---PNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVA 278

Mouse    74 NLYFLFIIILQGIPEISTLPWFTLFAPLVCLFVIRATRDLVDDIGRHRSDKIINNRPCQILRGKS 138
            ||||:||::|..:||||.........|::.:..:.|.:||.:|..|..|||.|||..|::..|::
  Fly   279 NLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGET 343

Mouse   139 FLWK--KWKNLCVGDVVCLSKDSIVPADLLLLASTEPSSLCYVETADIDGETNLKFRQALTVTHH 201
            ..:|  ||:.|.|||:|.||.:..||||:|||.:::|..:||::|.|:|||||||.|:.:. ...
  Fly   344 ERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVR-GFE 407

Mouse   202 ELTSPKKMASFQGTVTCEEPNSRMHHFVGSL-EWNSRKYPLDIGNLLLRGCKIRNTDTCYGLVIY 265
            |:.|....:.|...|..:.|.::::.|.|:| .....:.|:....||||..:::|||...|:|:|
  Fly   408 EMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVY 472

Mouse   266 AGLDTKIMKNCGKIHLKRTKLDLMMNKLVALIFLSLVIASLLLTVGFTFMVKQFKAKHY---YMS 327
            ||.:||.|.|......||::::..||..|....:.|:|..::..:|....:..|  .|:   |:.
  Fly   473 AGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSF--THFPVPYLP 535

Mouse   328 PTHGRSDAMESFFIFWGFLILLSVMVPMAMFIIAEFIYLGNSIFINWDLNMYYEPLDMPAKARST 392
            |....:: |||.:|||.::::|.||:|:::::..|...:.....|:.:::::....:...:.|:.
  Fly   536 PNKLTAN-MESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAM 599

Mouse   393 SLNDQLGQVQYIFSDKTGTLTQNIMTFKKCCINGCIYDSDDEHGTLRKRNPYAWNPFADGKLQFY 457
            ::.::|||:|:||:|||||||:|.|.|::|.:||    ||..|........|: .|.|.......
  Fly   600 NITEELGQIQHIFTDKTGTLTENKMIFRRCVVNG----SDYNHPPSELEKIYS-KPGAPAPPLIP 659

Mouse   458 NKELES----LVQGR----QDRAVQEFWRLLAICHTVMV-------------------------- 488
            |..|.|    |.||.    ..:.:|||..:||||:||:|                          
  Fly   660 NDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPAN 724

Mouse   489 ----------------------------------------------------------------- 488
                                                                             
  Fly   725 LKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQ 789

Mouse   489 ----------------------------------------------------------------- 488
                                                                             
  Fly   790 SHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGK 854

Mouse   489 -------------QEKDNQLLYQAASPDEEALVTAARNFGYVFLSRTQDTITLVEL---GEERVY 537
                         :..|.:.||:|.||||.|||.||.::....|:|:.:.| ||.:   |..|.|
  Fly   855 RMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQI-LVSMPMAGATREY 918

Mouse   538 QVLAMMDFNSVRKRMSVLVRNPEGS--ICLYTKGADTVILERL------RSKGVMEATTEEVLAA 594
            ::|.::.|:|.||.||::||. .||  |.|||||||:.|:..|      ..:|::...|:::|..
  Fly   919 EILKVLPFDSSRKCMSIVVRQ-IGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDR 982

Mouse   595 FAEQTLRTLCLAYKDVEEDAYKEWEPEHQEAALLLQNRAQALHQVYNKMEQNLQLLGATAIEDKL 659
            :|.:.||.|.:|.:.:....|.:|...|||..:.|:||.:.|...:.|:|.||.|||||.|||:|
  Fly   983 YAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRL 1047

Mouse   660 QDGVPETIKCLKKGNIKIWVLTGDKPETAVNIGFACQLLSENMIIL----EDKDINQ-VLERYWE 719
            ||||||||..|....|.:|||||||||||:||.::.:|.::.|.::    ..:|..: .:..|..
  Fly  1048 QDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYLT 1112

Mouse   720 DNVHQKAFKMMTHHNMALVINGEFLDQLLLSLRKEPRALVQNAVVDEVAQEPVVSALDFLQKRRI 784
            |..:.|....:.:        |:       ||||:.||||.:.           ..|.|:.    
  Fly  1113 DMENDKTTSTLGY--------GQ-------SLRKKQRALVVDG-----------KTLTFIL---- 1147

Mouse   785 SQMWRNAGPSLGTSHSADSKIRESPEVQRERAFVDLASKCQAVICCRVTPKQKALVVALVKKYQQ 849
                                   .|:.:....|:.|:.:|.:|:|||.||.|||.:|.:||:...
  Fly  1148 -----------------------DPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELN 1189

Mouse   850 VVTLAIGDGANDVNMIKTADIGVGLAGQEGMQAVQNSDYVLAQFCYLQRLLLVHGRWSYMRVCKF 914
            :.|||||||||||:||:.||:|||::||||||||..:|:.|.:|.||:||||.||.|.|.|:.:.
  Fly  1190 LRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRM 1254

Mouse   915 LRYFFYKTVASMMAQIWFSLVNGFSAQPLYEGWFLALFNLLYSTLPVLYIGLFEQDVTAEKSLKM 979
            :.|||||..|.:....|:.|..|||.|.:.:..:|.|:||::::||.|.||::::.|..:..||.
  Fly  1255 ILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKN 1319

Mouse   980 PELYMAGQKGELFNYSIFMQAITHGTITSMINFFVTVMVSSDMSKAGSSHDYQSLGVLVAISSLL 1044
            |.||..|:.|..:....|...:......|::.|||.:     .:.|.|.......|..:..|.|.
  Fly  1320 PYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVAL-----CAYAESDVGIWEFGTTITASCLF 1379

Mouse  1045 SVTLEVMLVVKYWTLLFVGAVVLSLSSYVLMTSLTQSLWMYRISPKTFPFLFADYNVLF----EP 1105
            :..:...:.::.||:|.|.::||||.|:.|...:..|:.|.....:      :.|.|:|    ..
  Fly  1380 ANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVR------SSYWVIFVCFASA 1438

Mouse  1106 CSLLLIVLNVALNVLPMLALRTIH---------RTVL---KQRPKGE 1140
            ...|:|:|:..:.|||.|.|.|:.         :.:|   ::|.:||
  Fly  1439 VHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVILQSKRERSRGE 1485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp8b3NP_080370.2 PhoLip_ATPase_N 20..96 CDD:292826 28/76 (37%)
ATPase-Plipid 45..1131 CDD:273734 392/1298 (30%)
Cation_ATPase 483..580 CDD:289987 46/277 (17%)
COG4087 <839..890 CDD:226572 30/51 (59%)
PhoLip_ATPase_C 883..1131 CDD:292829 78/261 (30%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 26/50 (52%)
ATPase-Plipid 250..1473 CDD:273734 392/1298 (30%)
E1-E2_ATPase 302..>394 CDD:278548 38/92 (41%)
Cation_ATPase <880..965 CDD:289987 38/87 (44%)
HAD_like <1177..1240 CDD:304363 38/63 (60%)
PhoLip_ATPase_C 1223..1468 CDD:292829 78/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.