DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 4933425L06Rik and NT5E-2

Sequence 1:NP_080027.1 Gene:4933425L06Rik MGIID:1914013 Length:585 Species:Mus musculus
Sequence 2:NP_611218.1 Gene:NT5E-2 FlyBaseID:FBgn0050104 Length:585 Species:Drosophila melanogaster

Alignment Length:514 Identity:129/515 (25%)
Similarity:226/515 (44%) Gaps:112/515 (22%)


Mouse    42 ILHFNDVY------DVDSSTEEP--------VGGAARFATAVKRF---------SILNPLLIFSG 83
            |||.||::      .|:|.|..|        .||.||.|..|:::         |:   |.:.:|
  Fly    35 ILHNNDMHARFDQTSVNSGTCPPEDVHTNKCYGGFARVAHEVRKYRKEAQEGGTSV---LYLNAG 96

Mouse    84 DCLNPSILSTITKGKHMISILNELGVHFAVFGNHEFDFGVDILEEYMKQMHF------------- 135
            |....:...||.|.|...:.||:|.......||||||..|:.|..::.::.|             
  Fly    97 DTYTGTSWFTIFKDKIASAFLNKLKPDAISLGNHEFDERVEGLIPFLNEVTFPVLACNLDLSKVP 161

Mouse   136 ----TWFLSNVHDRFTSEPLGHGAVKKIVNWNNRKIGLMGLVEEDWLDTLATVNKANVNYKDYVE 196
                ||.|:|               ..|:..|..|:|::|.:..   ||.......:|.:.:.||
  Fly   162 QLKATWHLAN---------------SAILETNGTKVGVIGYLTP---DTKKLTLNMDVEFNEEVE 208

Mouse   197 TANELAVELRAEGADLVIAMTHMKWKNDTRLAQHAEGLDLILGGH-------------DHEYG-- 246
            :.|..|.:|:|:|..::||:.|..:..|..:|::...:|:::|||             :|..|  
  Fly   209 SINVEAKKLKAQGIKIIIALGHSGYLKDLEIAKNCPEVDIVIGGHTNTFLYTGAQPDAEHIDGPY 273

Mouse   247 --IKKVN---ETWIVKSGSDFKNLTKIDIQLFDAS---FQYVFEKVEILSYLEEDSYIKAIVRDF 303
              :.|.|   |..:|::.:..|.|.|:.:| |||.   .|:....:.:.:.:.::..:..::..|
  Fly   274 PTMVKQNSGKEVPVVQAYAYTKYLGKLHVQ-FDADGNLIQWDGSPILLNASVAQEQDLLDLLEVF 337

Mouse   304 TQNIQYMLEEVLCPIDVALDGREITVRRCESNLGNLVTNAMLEA-----------THADVALLNS 357
            ..|:..:.:.|:....|.|:|.:...|..|.|||||:.:||:.:           |.|.::::..
  Fly   338 RPNVTRLEKSVVGHTKVHLEGNKAVCRAEECNLGNLIADAMVFSRLMEEQGGDFWTDAAISIMQG 402

Mouse   358 GTLRYD-RIHPPGNFTLHDLLAILPIVDPVLVVRATGAQLLEALENGVYKYPAL-----DGRFPQ 416
            |.:|.. .....|..|.:|:|::||..:.:.:|..||:.:..|||:|.    ||     ||.|.|
  Fly   403 GGIRSSIEKRSDGAITDNDILSVLPWGNKLYMVPMTGSTIRRALEHGA----ALRGKDSDGGFLQ 463

Mouse   417 VAGLEFGFDPDAEPGHRVIRDTVKVQG------QYLQRKKVYLLAIKEYIANGKDGYSM 469
            |:|:...|:.:...|.||:...|:...      ..|....:|.:.:.|::.:|.||:.|
  Fly   464 VSGIRVVFNSNKPEGQRVVSVQVRCAACRVPTYSDLNDTAIYNVVLGEFLLDGGDGHVM 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
4933425L06RikNP_080027.1 nadN 40..470 CDD:211667 129/515 (25%)
MPP_CG11883_N 40..293 CDD:277351 77/314 (25%)
5_nucleotid_C 328..466 CDD:280945 44/161 (27%)
NT5E-2NP_611218.1 MPP_CD73_N 33..320 CDD:277354 77/307 (25%)
nadN 35..520 CDD:211667 128/511 (25%)
5_nucleotid_C 348..519 CDD:280945 48/175 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0737
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127246
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.