DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SOX2 and Sox100B

Sequence 1:NP_003097.1 Gene:SOX2 HGNCID:11195 Length:317 Species:Homo sapiens
Sequence 2:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster

Alignment Length:310 Identity:83/311 (27%)
Similarity:132/311 (42%) Gaps:72/311 (23%)


Human    15 QQTSGGGGG--------------------NSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKM 59
            |:.:.|.||                    |...|:|........:.:||||||||||::..||.|
  Fly    31 QKKAQGQGGRKEDERITTAVMKVLEGYDWNLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVM 95

Human    60 AQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDK 124
            :::.|.:.|||:||.||..||.|.:::|:||::.|::||..|.:|||||||:|||| |..:...:
  Fly    96 SKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRK-KARVLPSQ 159

Human   125 YTLPGGLLAPG---------------------GNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSN 168
            .:..||  :||                     |...|......|.||:..:    :.:|.|..||
  Fly   160 QSGEGG--SPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGSCAS----TISHANVGSN 218

Human   169 GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDV-------SALQYNSMTSSQTYMNGSPTYSMS 226
            .|.....:..    ...||:..||.:......:.       :|...:|:|...|..|.:|:.:.:
  Fly   219 SSDVFSNEAF----MKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPATPYNVAPSNAKA 279

Human   227 YSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISM 276
             |....|.:.|..:          |.||..:........:||  |:.:::
  Fly   280 -SAANNPSLLLRQL----------SEPVANAGDGYGVLLEAG--REYVAI 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SOX2NP_003097.1 SOX-TCF_HMG-box 40..111 CDD:238684 38/71 (54%)
SOXp 110..200 CDD:315092 24/111 (22%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/70 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.