DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat1 and Nmnat

Sequence 1:NP_001343286.1 Gene:Nmnat1 MGIID:1913704 Length:285 Species:Mus musculus
Sequence 2:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster

Alignment Length:257 Identity:117/258 (45%)
Similarity:163/258 (63%) Gaps:20/258 (8%)


Mouse     9 VVLLACGSFNPITNMHLRLFELAKDYMHATGKYSVIKGIISPVGDAYKKKGLIPAHHRIIMAELA 73
            :..:|||.|:|.|.||||:||:|||:....|.:.|:.|||||..|:|.||||..|..|..|.:||
  Fly    46 IAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASALDRCAMVKLA 110

Mouse    74 TKNSHWVEVDTWESLQKEWVETVKVLRYHQEKL-----ATGSCSYPQSSPALEKPGRKRKWADQK 133
            |::|:|:.:..||..|.:|:.|..||::||..:     :.|.......:..|  ||    |..:.
  Fly   111 TQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGGDDGENTHL--PG----WLPRG 169

Mouse   134 QDSSPQKPQEPKPTGVPKVKLLCGADLLESFSVPNLWKMEDITQIVANFGLICITRAGSDAQKFI 198
            ...|    ::|     ..:||||||||||||:||.||...||..||||.||:.||||||:..|||
  Fly   170 LHDS----RDP-----VHLKLLCGADLLESFAVPGLWAEADIEDIVANHGLVVITRAGSNPGKFI 225

Mouse   199 YESDVLWRHQSNIHLVNEWITNDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHELYNTESE 260
            ::||:|.::||||.|:..|:.|::|||.|||.|.||||::||:.|||.|||::..|:|.:|:
  Fly   226 FDSDILTKYQSNITLITNWVPNEVSSTLIRRLLGRGQSVKYLLDDLVLEYIKRQRLFNFKSK 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nmnat1NP_001343286.1 NMNAT_Eukarya 9..255 CDD:185681 115/251 (46%)
Substrate binding. {ECO:0000250|UniProtKB:Q9HAN9} 55..57 1/2 (50%)
Substrate binding. {ECO:0000250|UniProtKB:Q9HAN9} 92..95 1/3 (33%)
Nuclear localization signal. {ECO:0000255} 123..129 2/6 (33%)
Substrate binding. {ECO:0000250|UniProtKB:Q9HAN9} 169..170 1/1 (100%)
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 115/251 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C18039954
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3551
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1308027at2759
OrthoFinder 1 1.000 FOG0001264
OrthoInspector 1 1.000 T616462
orthoMCL 1 0.900 OOG5_128044
Panther 1 1.100 O PTHR12039
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.