DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SNAI1 and wor

DIOPT Version :9

Sequence 1:	NP_005976.2	Gene:	SNAI1 / 6615	HGNCID:	11128	Length:	264	Species:	Homo sapiens
Sequence 2:	NP_476601.1	Gene:	wor / 34906	FlyBaseID:	FBgn0001983	Length:	548	Species:	Drosophila melanogaster

Alignment Length:	144	Identity:	94/144 - (65%)
Similarity:	111/144 - (77%)	Gaps:	6/144 - (4%)

- Green bases have known domain annotations that are detailed below.

Human   124 EAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKA 188
            ::|:.:.||.:  .|......|:..|.:|.|:||.|:|.|:||||||||||:|||||.|..||||
  Fly   352 KSYSTYSGLSK--HQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKA 414

Human   189 FSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHK 253
            ||||||||||:|||||||||||.||:||||||||||||:|||||||||.|..|.::|||||||.|
  Fly   415 FSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAK 479

Human   254 HQESGC----SGCP 263
            |.:|||    ||.|
  Fly   480 HLQSGCQTEQSGGP 493

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SNAI1	NP_005976.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..27
		SNAG domain. /evidence=ECO:0000305\|PubMed:20389281, ECO:0000305\|PubMed:21300290	1..20
		Required and sufficient for interaction with KDM1A. /evidence=ECO:0000269\|PubMed:20389281, ECO:0000269\|PubMed:23721412	2..7
		LATS2 binding	10..40
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	86..115
		Destruction motif	95..100
		Required for FBXL14-triggered degradation	120..151		6/26 (23%)
		Required for nuclear localization and interaction with KPNB1, NOTCH1 and PARP1. /evidence=ECO:0000269\|PubMed:21577210, ECO:0000269\|PubMed:22128911	151..264		88/117 (75%)
		C2H2 Zn finger	156..176	CDD:275368	15/19 (79%)
		C2H2 Zn finger	182..202	CDD:275368	16/19 (84%)
		zf-H2C2_2	195..218	CDD:404364	19/22 (86%)
		zf-C2H2	208..230	CDD:395048	18/21 (86%)
		C2H2 Zn finger	210..230	CDD:275368	16/19 (84%)
		C2H2 Zn finger	238..255	CDD:275368	10/16 (63%)
wor	NP_476601.1	C2H2 Zn finger	270..290	CDD:275368
		C2H2 Zn finger	317..334	CDD:275368
		zf-C2H2	345..367	CDD:278523	4/16 (25%)
		C2H2 Zn finger	347..367	CDD:275368	4/16 (25%)
		PHA00732	379..>417	CDD:177300	27/37 (73%)
		C2H2 Zn finger	382..402	CDD:275368	15/19 (79%)
		zf-C2H2_8	405..482	CDD:292531	62/76 (82%)
		zf-C2H2	406..428	CDD:278523	17/21 (81%)
		C2H2 Zn finger	408..428	CDD:275368	16/19 (84%)
		zf-H2C2_2	421..444	CDD:290200	19/22 (86%)
		zf-C2H2	434..456	CDD:278523	18/21 (86%)
		C2H2 Zn finger	436..456	CDD:275368	16/19 (84%)
		zf-H2C2_2	448..473	CDD:290200	17/24 (71%)
		C2H2 Zn finger	464..481	CDD:275368	10/16 (63%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0012001
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X955
SwiftOrtho	1	1.000	-	-
TreeFam	1	0.960	-	-
User_Submission	0	0.000	Not matched by this tool.
	7	6.770