DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SNAI1 and wor

Sequence 1:NP_005976.2 Gene:SNAI1 HGNCID:11128 Length:264 Species:Homo sapiens
Sequence 2:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster

Alignment Length:144 Identity:94/145 (65%)
Similarity:111/145 (77%) Gaps:6/145 (4%)


Human   124 EAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKA 188
            ::|:.:.||.:  .|......|:..|.:|.|:||.|:|.|:||||||||||:|||||.|..||||
  Fly   352 KSYSTYSGLSK--HQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKA 414

Human   189 FSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHK 253
            ||||||||||:|||||||||||.||:||||||||||||:|||||||||.|..|.::|||||||.|
  Fly   415 FSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAK 479

Human   254 HQESGC----SGCP 263
            |.:|||    ||.|
  Fly   480 HLQSGCQTEQSGGP 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SNAI1NP_005976.2 SNAG domain. {ECO:0000250} 1..20
LATS2 binding 10..40
Destruction motif 95..100
Required for FBXL14-triggered degradation 120..151 6/27 (22%)
Required for nuclear localization and interaction with KPNB1, NOTCH1 and PARP1. {ECO:0000269|PubMed:21577210, ECO:0000269|PubMed:22128911} 151..264 88/118 (75%)
C2H2 Zn finger 156..176 CDD:275368 15/20 (75%)
COG5048 <177..>253 CDD:227381 62/76 (82%)
C2H2 Zn finger 182..202 CDD:275368 17/20 (85%)
zf-H2C2_2 195..218 CDD:316026 20/23 (87%)
C2H2 Zn finger 210..230 CDD:275368 17/20 (85%)
C2H2 Zn finger 238..255 CDD:275368 11/17 (65%)
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368
C2H2 Zn finger 317..334 CDD:275368
zf-C2H2 345..367 CDD:278523 4/17 (24%)
C2H2 Zn finger 347..367 CDD:275368 4/17 (24%)
PHA00732 379..>417 CDD:177300 28/38 (74%)
C2H2 Zn finger 382..402 CDD:275368 15/20 (75%)
zf-C2H2_8 405..482 CDD:292531 62/77 (81%)
zf-C2H2 406..428 CDD:278523 18/22 (82%)
C2H2 Zn finger 408..428 CDD:275368 17/20 (85%)
zf-H2C2_2 421..444 CDD:290200 20/23 (87%)
zf-C2H2 434..456 CDD:278523 19/22 (86%)
C2H2 Zn finger 436..456 CDD:275368 17/20 (85%)
zf-H2C2_2 448..473 CDD:290200 18/25 (72%)
C2H2 Zn finger 464..481 CDD:275368 11/17 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2462
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.