DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HLTF and CG10445

Sequence 1:XP_011511393.1 Gene:HLTF HGNCID:11099 Length:1013 Species:Homo sapiens
Sequence 2:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster

Alignment Length:1050 Identity:256/1050 (24%)
Similarity:407/1050 (39%) Gaps:290/1050 (28%)


Human    79 NNEMVALQRDPNNPYDKNAIKVNN-VNGNQVGHLKKELAGALAYIMDN-------------KLAQ 129
            :.:..::|...:.|...::.::|| :....|..|  ||:|..|   ||             |.||
  Fly    13 HKQSCSIQDQSSVPVPDSSGEINNWMEPEPVDSL--ELSGEYA---DNESAIFVSASEYNEKKAQ 72

Human   130 IEGVVPFGANNAFTMPLHMTFWGKEENRKAVSD--QLKKHGFKLGPAPKTLG------------- 179
            |:.:|    ....||.....  ..|||.....:  .||.|..||....:.||             
  Fly    73 IDQLV----QKILTMEQQQR--QLEENASETKELCDLKLHLEKLNARLEALGEFLDTLRLREDQQ 131

Human   180 -------------------FNLESGWGSGRAGPSYSMPVHAAVQM------TTEQLKTEFDKL-- 217
                               .||.||....|...:     |.|.|.      ..:.|||.::.:  
  Fly   132 EIKIEDNSELVDHTEQPKWSNLYSGLNRYRQKAN-----HTAAQFYQHKSNIIDSLKTLYEPIQP 191

Human   218 ---FEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFS 279
               .:||       |.:|| .:...||.||:..|.||..||..|                     
  Fly   192 RPAIDDL-------EKQPA-LLLVRLLKHQQSCLKWMQFRERQK--------------------- 227

Human   280 EKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGN 344
                   :.||||||||||||||:.||:||.:         |..|..  |:|             
  Fly   228 -------ISGGILADDMGLGKTLSMIALILAS---------EETKNR--KRE------------- 261

Human   345 NTSEKADGLSKDASRCSEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELP 409
               ||...|:...::...:....:|::.|.|...|.|.      |...||    :..|..|..:.
  Fly   262 ---EKKKALTLKWTQEFNRVYCKEIRKISMFDDEEESG------KEEEQY----EPPEKRTCHVK 313

Human   410 QKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPTTKKKMLKKGACAVEGSKKTDVEER 474
            .|...:.:.:..:..   .||...|:||             .:|.:|.| ....|.....:.||.
  Fly   314 TKKINQFRILDDDDN---DAGDKAVVED-------------EQKDLLAK-TPEPEVFSSDEEEEH 361

Human   475 -------PRTTLIICPLSVLSNWIDQFGQHIKSDVHLNFYVYYGPDR--IREPALLSKQDIVLTT 530
                   ...||::||:||:..|..:....:..:. :....::||:|  |...|..| .|:|:|:
  Fly   362 LSNGRYPSANTLVVCPMSVMCQWAHEVASKVAQNA-IRVLTFHGPNRHEIGIEAFRS-YDLVITS 424

Human   531 YNILTHDYGTKGD-SPLHSIRWLRVILDEGHAIRNPNAQQTKAVLDLESERRWVLTGTPIQNSLK 594
            ||::.::....|: |||.::.|.||||||.|.|||.......:|..|.:...|.|||||:||...
  Fly   425 YNLVVNELKRYGNTSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGV 489

Human   595 DLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGLRRLQSLIKNITLRRTKTSKIKGKPVLELP 659
            |:::||.|:.:..|.|.:.|.:.:...:.     |.|||..:||.:.|||||........:..||
  Fly   490 DVFALLRFVNVPNFQDLQQWKKNLNESML-----GHRRLNFIIKPLMLRRTKQKLQASGDMPALP 549

Human   660 ERKVFIQHITLSDEERKIYQSV--------------KNEGRATIGRYFNEGT---VLAHYAD--- 704
            ..|:.:..:.||..|..:||.:              :.:|.:.:..|..|.|   :..|.:|   
  Fly   550 SLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDERY 614

Human   705 -----------------------VLGLLLRLRQICCHTYL----LTNAVSSNGPSAFSL-GNDTP 741
                                   :|.|||||||.|||..|    |..|:::.......: .:|..
  Fly   615 NEIYERFLKSLGYNPGEKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVDASDVE 679

Human   742 EELRKKLIRKMKLILSSGSDEECAICLDSLTVPVITHCAHVFCKPCICQVIQNEQPHAKCPLCRN 806
            .:|:..::.::.....:.|:::|....||                      .....:.|..:.::
  Fly   680 GQLKMDVLAELDKFDETDSEDDCCDEEDS----------------------TRRDGNFKLEVIKD 722

Human   807 DIHEDNLLECPPEELARDSEKKSDMEWTSSSKINALMHALTDLRKKNP----------------- 854
            :|.|:|:    |.:...|....|..|....|     ..||..|..:||                 
  Fly   723 EIKEENV----PWDSGDDLPTASSFEDQLDS-----ARALKLLNPQNPIFQFIRPSAKLKMVIDK 778

Human   855 --------NIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQ-NTEAGSPT 910
                    |.|.:|.||:.::|:::...|:...:.....:|.:..|:|...::.|. |.|   ..
  Fly   779 LEELLTGTNDKIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFNANNE---KR 840

Human   911 IMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENML 975
            ::||||.||||||||:.|:.:.::|..|||..|.|..||.:|.||.:...|.:::.:|:||:.:.
  Fly   841 VLLLSLTAGGVGLNLNVANHMLIVDLHWNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIK 905

Human   976 KIQNKKRELA 985
            .:|:.|.|:|
  Fly   906 SLQDCKLEIA 915

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HLTFXP_011511393.1 HIRAN 60..155 CDD:285949 20/90 (22%)
DEXDc 238..>320 CDD:214692 28/82 (34%)
DEXDc 288..>320 CDD:238005 18/32 (56%)
SNF2_N 472..722 CDD:278600 89/307 (29%)
DEXDc <478..588 CDD:238005 40/113 (35%)
RING 763..808 CDD:238093 4/45 (9%)
Helicase_C 836..954 CDD:278689 41/144 (28%)
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 142/532 (27%)
DEXDc <372..483 CDD:238005 40/113 (35%)
HELICc 761..892 CDD:238034 39/134 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3486
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.