DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC22A5 and CG4630

Sequence 1:NP_001295051.1 Gene:SLC22A5 HGNCID:10969 Length:581 Species:Homo sapiens
Sequence 2:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster

Alignment Length:605 Identity:186/606 (31%)
Similarity:313/606 (52%) Gaps:98/606 (16%)


Human     3 DYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSSA-----W 62
            |:|::...:||:|.|||..:.|:...::......||.||...:|.:||.||:...|..|     |
  Fly    14 DFDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGANW 78

Human    63 RNHTVP-LRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWE-------F 119
            .:..|| ...:.|...|.:|.|:    :||...|               ||..|.|.       |
  Fly    79 VSIAVPGSWSKRGHFTPSTCERF----VANGDHL---------------ESSSDPWSAWPLDQCF 124

Human   120 SQDVYLSTIVTEQ-DSGAYNAMKNRMGKKPALCLPAQWNLVC-EDDWKAPLTISLFFVGVLLGSF 182
            :::.   |..||: :...|.:.:.        .:..||.|.| |:.||.....::.|.|:::|:.
  Fly   125 AENF---TTETERCNQFVYGSSER--------TIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTA 178

Human   183 ISGQLSDRFGRKNV-LFVTMGMQ-TGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEI 245
            :||.|:||:|||:: ||..:.|. ||.:  |..|.::..|:...:|..:|....|..||::|.|:
  Fly   179 LSGYLADRYGRKHIFLFCIVFMALTGVA--QALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEM 241

Human   246 LGKSVRIIFSTLGVCIFYAFGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLIS 310
            :|...|.: |::.:..|||.|..:|.| :.|:.|||.|.:||::|.::|||.:|.:|||.|||::
  Fly   242 VGPRKREM-SSIVLNYFYAVGEALLGL-SVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLA 304

Human   311 QGRFEEAEVIIRKAAKANGIVVPSTIFDPSELQDLSSKKQQSHN----------------ILDLL 359
            :.|.|:|.||||:|||.|...:...:....:.|:|.::..|..:                :.::.
  Fly   305 RNRREQAGVIIRRAAKVNRRDISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVA 369

Human   360 RTWNIRMVTIMSIMLWMTISVGYFGLSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRR 424
            |:..:.....:.:::|...::.|:||||:..:|.|:.::|..|..:||:|.|.||||.|:...||
  Fly   370 RSHILMGRYAILLLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRR 434

Human   425 YSMATALFLGGSVLL---------FMQLVPPD----------------LYYLATVLVMVGKFGVT 464
            .:      |.||:||         |:.|...|                ..:|...|.:|||.|:|
  Fly   435 VA------LSGSLLLCSITCVASGFVTLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGIT 493

Human   465 AAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAIL 529
            ::|:::|.:|||:.|||:|:.||||.||.:|.|::|:|:...|.:|...||.:|.|:|:::..:|
  Fly   494 SSFAVIYTFTAEMMPTVIRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLL 558

Human   530 TLFLPESFGTPLPDTIDQML 549
            :|.|||:|...||||:::.:
  Fly   559 SLLLPETFNRKLPDTVEEAI 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A5NP_001295051.1 2A0119 12..544 CDD:273328 183/590 (31%)
MFS 162..534 CDD:119392 135/415 (33%)
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 183/590 (31%)
MFS 158..533 CDD:119392 125/385 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103673326
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.