DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC16A2 and CG13907

DIOPT Version :9

Sequence 1:NP_006508.2 Gene:SLC16A2 / 6567 HGNCID:10923 Length:539 Species:Homo sapiens
Sequence 2:NP_001286894.1 Gene:CG13907 / 38104 FlyBaseID:FBgn0035173 Length:816 Species:Drosophila melanogaster


Alignment Length:747 Identity:138/747 - (18%)
Similarity:232/747 - (31%) Gaps:318/747 - (42%)


- Green bases have known domain annotations that are detailed below.


Human    94 PPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCS 158
            ||:||:|||:.||:..||..:.||..:.||    .|||......:.:...||||:|..|:.....
  Fly    71 PPDGGYGWVICFASFMCNMIVDGIAYTFGI----FLEEFVAYFHEGKGTVAWVGSLLSGVYLSAG 131

Human   159 PIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHY 223
            ||||...::.|||....||:.:|.|....|:|::::|:...|||.:.|.|....:.|::|.:|:|
  Fly   132 PIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVGYY 196

Human   224 FQRRLGLANGVVSAGSSIFSMSF----PFLIRMLGDKIKLAQTFQ--VLSTFMFVLMLLSLTY-- 280
            |:.:..||.|:...||...:.:|    .:|:...|.|..|. .|.  :|:..:|..|:..|||  
  Fly   197 FETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALL-IFAGLILNCAIFGAMMRPLTYPK 260

Human   281 ----RPL---------------------------------------------------------- 283
                :||                                                          
  Fly   261 KKKQKPLMQRMYEEKQLQLERGSFAGSHFMVQLPDGTIERKLKMPLNADPGVHSSLNLELLAQQA 325

Human   284 ----------LPS---------------------------------------------------- 286
                      ||:                                                    
  Fly   326 GGGGLHPVSTLPTITESKVVDVHRQNGAQSPPNGDSNGQLSARSAAGAVGRRPHRNSESENSPYH 390

Human   287 SQDT-----------------------------------------PSKRGVR------------- 297
            |||.                                         ||...:|             
  Fly   391 SQDAMTRNASQPAFLAGDHQSLPKNGSVPAFNTRVRKTSASERFQPSLAAIRATSRGDLEAGAGG 455

Human   298 -------TLHQRF---------------------------------------------------- 303
                   :|.||.                                                    
  Fly   456 DFASSKLSLSQRQGGSQTGSSGRMVRPMSRKDIFYSGSVTNLPQYQSQKSLANYRNSVLSLTKYE 520

Human   304 -----------LAQLRKY-----------------------FNMRVFRQRTYRIWA----FGIAA 330
                       ||:..|:                       .::.:.:...:.:..    ||:| 
  Fly   521 KSMQSVAKLDPLAEAEKHREEYDLCPCLGIPDSVKSVVNTMLDVSLLKDPVFMLIGVSNIFGMA- 584

Human   331 AALGYFVPYVHLMKYVEEEFSEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFL 395
               |.:||:|:|:...:|......:..:||..||.|:.:||:..|.::| :|.:..:.|.....|
  Fly   585 ---GLYVPFVYLVDAAKEHDIPKNDAAMLLSIIGITNTVGRVFCGWVAD-LPQVNSLLLNNCCLL 645

Human   396 LLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMI 460
            :..:...:.|||..:...|.:.:|.||....:|::.:.|..:|:|..:.:.|.|.|:.......:
  Fly   646 VSTIAVTLTPLCYSYAAYITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLLILFRGFAAL 710

Human   461 AGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQ--------------RMFKKEQRD 511
            .|.|:||.:.:....|.:.||.||....|..:..|..|.:.:              ....:||.:
  Fly   711 IGTPLAGAIYDMTHTYDLPFYMAGALFGISTITSFLAPCLKRCSPSEETPVHVETLTPIDEEQGE 775

Human   512 SSKDKMLAPDPDPNGELLP------GSPNPEE 537
            .::|     |.|....::|      .||..||
  Fly   776 DAED-----DEDQPITIVPKIIKTLASPQQEE 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC16A2NP_006508.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92
2A0113 86..513 CDD:273325 130/715 (18%)
MFS 101..498 CDD:119392 122/679 (18%)
DUF1564 <286..>334 CDD:284922 15/250 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..539 10/36 (28%)
CG13907NP_001286894.1 MFS 78..>258 CDD:119392 58/184 (32%)
MFS <570..748 CDD:119392 46/182 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145580
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 1 1.000 - - FOG0000033
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.