DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC6A13 and CG8850

Sequence 1:NP_057699.2 Gene:SLC6A13 HGNCID:11046 Length:602 Species:Homo sapiens
Sequence 2:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster

Alignment Length:530 Identity:197/531 (37%)
Similarity:303/531 (57%) Gaps:14/531 (3%)


Human    25 EEDGTLERGHWNNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLVFLFTCGIPVFLLE 89
            |.:.:.:|..|:..:||:.|.....:|||||||||::..:||||||.|||::.|...|.||:.||
  Fly    50 ESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLE 114

Human    90 TALGQYTSQGGVTAWRKICPIFEGIGYASQMIVILLNVYYIIVLAWALFYLFSSFTIDLPWGGCY 154
            ..:||::|:|.:.|: .:.||..||.|.......|...||..::|..:.||.:||:..|||..|.
  Fly   115 VIIGQFSSRGCIRAF-DMAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCL 178

Human   155 HEWNTEHCMEFQKTNGSLNGTSENATSPVIEFWERRVLKISDGIQH--LGALRWELALCLLLAWV 217
            .||. :.|:....|..:.:...:..:|..: |:.:.||:..:.:..  ||...|:|.||||..||
  Fly   179 VEWG-KSCVATGATAANDSSIVQGVSSAEL-FFTQTVLREPESLDDNGLGTPSWDLVLCLLATWV 241

Human   218 ICYFCIWKGVKSTGKVVYFTATFPYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDA 282
            |....:.||::|:||..||.|.|||::::|||||.||||||.|||.::|.|..::|.:|.||..|
  Fly   242 IIGTILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAA 306

Human   283 GTQIFFSFAICLGCLTALGSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGV-P 346
            .||:|||.|||.|.|....|:|.::.|.::|.|.:..::|.||.:||..||.|||.::.|... .
  Fly   307 ITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETNTKD 371

Human   347 ISEVAESGPGLAFIAYPRAVVMLPFSP-LWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPHVF 410
            ||:|.:.|.|||||:||.|:....:.| |:|..||||:::||:.|......::|..:.|.:.|: 
  Fly   372 ISQVVKGGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHL- 435

Human   411 RKKNRREVLILGVSVVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAKR 475
                ...:|.:..|::.||.||:.:|.||.:|..|.|:|..:.:.|: :||.|.|.|.|:||.||
  Fly   436 ----PHWLLAVSASIIGFLCGLVYMTPGGQFVLNLVDFYGCTFIALV-LAIAELLAVGWIYGVKR 495

Human   476 FYDNIEDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS 540
            ...:||.|:..:.....:.||..:.|.:.....::.|..|.|||| :...||......||::...
  Fly   496 ICSDIEFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTY-RGVQYPPVYYMAGWIIWGL 559

Human   541 SMVCIPAWSL 550
            .::.:|.|:|
  Fly   560 GVLQLPFWAL 569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A13NP_057699.2 SLC6sbd_GAT2 32..575 CDD:271396 196/524 (37%)
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 182/483 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106224372
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.