DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC6A7 and CG8850

Sequence 1:XP_016865256.1 Gene:SLC6A7 HGNCID:11054 Length:754 Species:Homo sapiens
Sequence 2:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster

Alignment Length:642 Identity:224/643 (35%)
Similarity:348/643 (54%) Gaps:62/643 (10%)


Human    82 MKKLQGAHLRKPVTPDLLMTP--SDQGD-----VDLDVDFAAHRGNWTGKLDFLLSCIGYCVGLG 139
            |:..||:....|.:.|.:.|.  |.:|:     .:.:.:.:..|..|:..::||.|||...||||
  Fly    14 MQGAQGSREGHPGSNDGISTVIYSAEGEELTINCEAESESSGQRDQWSRGVEFLFSCIALSVGLG 78

Human   140 NVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAML 204
            ||||||:.|..|||||||:||.::|.:.|.|:::||:.:|||||.|.:..:.::|:.:|.....:
  Fly    79 NVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRGIAYGQV 143

Human   205 LIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVS 269
            ....|...||..|:|..:.||.||.:..|||.:|...|. :.|    |:.....|...::...||
  Fly   144 YSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWG-KSC----VATGATAANDSSIVQGVS 203

Human   270 PSEEYWSQTHTEAEEEGRRGRVVSNSYPQVIFLPQPPKAEEGVSRYVLHIQGSQGIGSPGEIRWN 334
            .:|.:::||                      .|.:|...::            .|:|:|.   |:
  Fly   204 SAELFFTQT----------------------VLREPESLDD------------NGLGTPS---WD 231

Human   335 LCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHH 399
            |.||||..|||:...:.||::||||..||.|.|||:|:::||:|.|||||||:||.::|.||:..
  Fly   232 LVLCLLATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQ 296

Human   400 LLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLG 464
            ||:..||..|..|:|:||.:.||.|:.:||:|.|::|:::|..|:|..:::||||||..||.:||
  Fly   297 LLNPHVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILG 361

Human   465 YMSQELGV-PVDQVAKAGPGLAFVVYPQAMTMLPLSP-FWSFLFFFMLLTLGLDSQFAFLETIVT 527
            .::.|... .:.||.|.|.||||:.||:|:......| .::.|||||||.||:.|.......:|.
  Fly   362 NLAFETNTKDISQVVKGGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVN 426

Human   528 AVTDEF---PYYLRPKKAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCL 589
            .|.|.|   |::|....|...|.:|      ||:..|.||.:.|.|:|.|..:|..:|:.|...|
  Fly   427 VVKDRFTHLPHWLLAVSASIIGFLC------GLVYMTPGGQFVLNLVDFYGCTFIALVLAIAELL 485

Human   590 AVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAE 654
            ||..:||::|.|.||..||..|...|:|.||..::|..:..::||.:..|:|..|...::||...
  Fly   486 AVGWIYGVKRICSDIEFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYY 550

Human   655 LLGILMGLLSCLMIPAGMLVAVLREEGSLW-ERLQQASRPAMDWGPSLEENRTGMYV 710
            :.|.::..|..|.:|...||.:.::.|..: .:...|.:|..:||| |:..:...|:
  Fly   551 MAGWIIWGLGVLQLPFWALVTIYQQPGKTFGSKFGLAMQPTANWGP-LQTQKFEAYI 606

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC6A7XP_016865256.1 None
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 196/522 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107529074
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.