DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: WNK1 and Madm

Sequence 1:XP_011519299.1 Gene:WNK1 HGNCID:14540 Length:2795 Species:Homo sapiens
Sequence 2:NP_001303420.1 Gene:Madm FlyBaseID:FBgn0027497 Length:637 Species:Drosophila melanogaster

Alignment Length:699 Identity:170/700 (24%)
Similarity:267/700 (38%) Gaps:220/700 (31%)


Human   131 SQVAQQP----PAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP----ARSGSGG 187
            |.||.:|    |:.|       |||..::.|::|    |.||     |.::|||    |.:...|
  Fly    13 STVADEPIQHHPSLA-------AGPVSASCPAAT----PPSQ-----STQQPPPHIVSASTADAG 61

Human   188 GSA----------------KEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGR---GSFK 233
            .||                ..|:|.....:|:.|.||.     |..||:||...|:.:   ....
  Fly    62 SSAAVGVGVVAGSEGVNLDSSPRESGDDSEDESEILEE-----SPCGRWLKRREEVDQRDVPGID 121

Human   234 TVYKGLDTETTVEVAWCELQDRKL--TKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKK- 295
            .|:..:|||..|||.|.|:|...|  .||:.::.::..:.|..|.|.|||:|:..|..|.:.:: 
  Fly   122 CVHLAMDTEEGVEVVWNEVQYASLQELKSQEEKMRQVFDNLLQLDHQNIVKFHRYWTDTQQAERP 186

Human   296 CIVLVTELMTSGTLKTYLKR----FKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIF 356
            .:|.:||.|:||:||.:|||    .|.:.::..|.||.|||..|.:||:.:|||||.:|.||:||
  Fly   187 RVVFITEYMSSGSLKQFLKRTKRNAKRLPLESWRRWCTQILSALSYLHSCSPPIIHGNLTCDSIF 251

Human   357 ITGPTGSVKIGDLGLATLKRASFAKSVI--------------------GTPEFMAPEM-YEEKYD 400
            |. ..|.||||              ||:                    |...|.|||. ..::..
  Fly   252 IQ-HNGLVKIG--------------SVVPDAVHYSVRRGRERERERERGAHYFQAPEYGAADQLT 301

Human   401 ESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPE-------------- 451
            .::|:||||||.||||..|                   ::|::.:..||.|              
  Fly   302 AALDIYAFGMCALEMAALE-------------------IQPSNSESTAINEETIQRTIFSLENDL 347

Human   452 VKEIIEGCIRQNKDERYSIKDLLNHAFFQE-----------------------ETG--------- 484
            .:::|..|:.....:|.|..|||.|....|                       ||.         
  Fly   348 QRDLIRKCLNPQPQDRPSANDLLFHPLLFEVHSLKLLTAHCLVFSPANRTMFSETAFDGLMQRYY 412

Human   485 ------VRVELAEEDDGE------KIAIKLWLRIEDIK-------KLKGKYKDNEAIEFSFDLER 530
                  .::.||...:.:      ..|.||...:||:|       ...||...|.....:.....
  Fly   413 QPDVVMAQLRLAGGQERQYRLADVSGADKLEKFVEDVKYGVYPLITYSGKKPPNFRSRAASPERA 477

Human   531 DVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQ-----LVREEQEKKKQEESSLK 590
            |..:....|.|:          |.::.|.:.:..:|.|.:...     |:|.:.:..:|    |.
  Fly   478 DSVKSATPEPVD----------TESRRIVNMMCSVKIKEDSNDITMTILLRMDDKMNRQ----LT 528

Human   591 QQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVE----PEEPEADQHQQLQYQQPSISVLS 651
            .||.::.                     |:|.:::::.    ....:.|:.|.|..:.....|:|
  Fly   529 CQVNEND---------------------TAADLTSELVRLGFVHLDDQDKIQVLLEETLKAGVMS 572

Human   652 DGTVDSGQGSSVFTESRVSS-QQTVSYGSQHEQAHSTGTVPGHIPSTVQ 699
            ||......|:.|.|.:.::: :|.....|....|...||...::|...|
  Fly   573 DGAGAESSGAGVTTTATMAALEQLERNWSISSDADKQGTAVMYVPQEQQ 621

Known Domains:


GeneSequenceDomainRegion External IDIdentity
WNK1XP_011519299.1 STKc_WNK1 195..483 CDD:270932 103/356 (29%)
S_TKc 226..479 CDD:214567 91/298 (31%)
OSR1_C 500..537 CDD:289010 9/44 (20%)
MadmNP_001303420.1 PK_NRBP1_like 114..376 CDD:270886 90/296 (30%)
S_TKc 123..375 CDD:214567 90/286 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92313868
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.