DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: WNK1 and Wnk

Sequence 1:XP_011519299.1 Gene:WNK1 HGNCID:14540 Length:2795 Species:Homo sapiens
Sequence 2:NP_001262171.2 Gene:Wnk FlyBaseID:FBgn0037098 Length:2462 Species:Drosophila melanogaster

Alignment Length:2781 Identity:719/2782 (26%)
Similarity:1030/2782 (37%) Gaps:878/2782 (32%)


Human   123 ETVTATA-TSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSG 186
            :.:|..| :|:.:.:..|.......|.|.|.|||...||:                         
  Fly   405 DDITKKAESSEASAEEAAVTGSSTDASASPLPSTSLVSTT------------------------- 444

Human   187 GGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCE 251
             .||....:.:|.:.||       .|.||..|||.|:|.|:|||||||||:||||.|.|.|||||
  Fly   445 -SSATSITKSKSDEDDD-------PVAMSPCGRFFKYDKEVGRGSFKTVYRGLDTLTGVPVAWCE 501

Human   252 LQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRF 316
            |.|:::.||||.||:|||:|||.||||||||||..||..:..||.||||||||.|||||:|||||
  Fly   502 LLDKQVKKSERTRFREEADMLKKLQHPNIVRFYTYWEFPIGRKKNIVLVTELMLSGTLKSYLKRF 566

Human   317 KVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAK 381
            |.:..|||:||||||||||.|||||..||||||||||||||||.|||||||||||||||..|.||
  Fly   567 KKIHPKVLKSWCRQILKGLNFLHTRQFPIIHRDLKCDNIFITGTTGSVKIGDLGLATLKNRSHAK 631

Human   382 SVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDK 446
            ||||||||||||||||.||||||||||||||||||.||||||||:..||||::|.||:|||:..|
  Fly   632 SVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMAISEYPYSECKGPAQIYKKVISGIKPAALAK 696

Human   447 VAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVE-LAEE---DDGEKIAIKLWLRIE 507
            |..|.|::|||.||...|::|.|..:||...||.|:.|:||| .|.|   .|.....|:..||..
  Fly   697 VEDPNVRDIIERCIELKKEDRPSCNELLESEFFDEDIGIRVEPTASEQFLSDPSISIIEFRLRFM 761

Human   508 DIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDR-VSLIKRKREQ 571
            |.||...::|:||||:|.:::..|..|.:||||::...:.|.|.:.:|:.:|.: |||:|.:.::
  Fly   762 DPKKRSSRHKENEAIQFEYNIRHDEYEQIAQEMMKENIISEDDSRAVARLLKVQVVSLLKERAQR 826

Human   572 RQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQ 636
            :..::.:.||.:.|:.:|::|.|                 .:||..........:.|.||.....
  Fly   827 QTQIKLQNEKSRLEKLALQKQRE-----------------SLPTNVDEDEEEEEESEDEEDGVKW 874

Human   637 HQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQ 701
            :|:||.:...::                |:|..|            .|.||.:|.....||....
  Fly   875 NQRLQLRYDLLN----------------TDSETS------------LALSTNSVEPQQLSTRSNT 911

Human   702 SQPH-GVYPPSSVPQSMAHPCGGTPTYPESQIFFPTIHERPVSFSPPPTCPPKVAISQRRKSTSF 765
            |.|: |:..|..||..:          |.||:           .|..|...|..||..::|.|  
  Fly   912 SIPNSGIQQPVQVPGQV----------PVSQL-----------ISVQPQAIPSPAIPMQQKPT-- 953

Human   766 LEAQTHHFQPLLRTVGQSLLPPGGSPTNWTPEAVVMLGTTASRVTGESCEIQVHPMFEPSQVYSD 830
                .|:.||          |...|..|.......|........||             ||....
  Fly   954 ----VHYIQP----------PQLASYQNSNASMQEMTNNQVISPTG-------------SQQMQQ 991

Human   831 YRPGLVLPEEAHYFIPQEAVYVAGVHYQARVAEQYEGIPYNSSVLSSPMKQIPEQKPVQGGPTSS 895
            .:| :|.|...|..:||:.|            .|.:..|       ..|:|||:|..||...|  
  Fly   992 QQP-VVAPTVNHQVMPQQQV------------NQQQQQP-------QMMQQIPQQVQVQQPQT-- 1034

Human   896 SVFEFPSGQAFLVGHLQNLRLDSGLGPGSPLSSISAPISTDATRLKFHPVFVPHSAPAVLTHNNE 960
                                    :.|..|                                   
  Fly  1035 ------------------------VLPPQP----------------------------------- 1040

Human   961 SRSNCVFEFHVHTPSSSSGEGGGILPQRVYRNRQVAVDLNQEELPPQSVGLHGYLQPVTEEKHNY 1025
                     |...|..........|.|.::.|.| |.||.|::...|... ..|.|...::    
  Fly  1041 ---------HEQQPQQQQQPLQQQLQQLMHTNVQ-APDLTQQQQMAQQQA-QQYFQQQQQQ---- 1090

Human  1026 HAPELTVSV-----VEPIGQNWPIGSPEYSSDSSQITSSDPSDFQSPPPTGGAAAPFGSDVSMPF 1085
              |:..|::     ::..||...:..|                                      
  Fly  1091 --PQQAVNMQQAYAMQQAGQQQQLSQP-------------------------------------- 1115

Human  1086 IHLPQTVLQESPLFFCFPQGTTSQQVLTASFSSGGSALHPQAQGQSQGQPSSSSLTGVSSSQPIQ 1150
            :.:.|.:||:..:.....|....||:          |.| |.|...|.|.....|          
  Fly  1116 LQIQQQILQQQQVAVSHQQQIMQQQL----------AQH-QLQQLQQQQLQQQQL---------- 1159

Human  1151 HPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPVSQPQAPQVLPQVSAGKQLPV----SQPV 1211
              ||||.|||    ||..|..|.|.....:...|.|..|.|      |:..|.|:..    .||:
  Fly  1160 --QQQQQIQQ----QQLQQQQLQQQQFVQQYAQAMPQQQHQ------QLVTGSQVMAPHQHQQPI 1212

Human  1212 PTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPTPLLPQYPVSQIPISTPHVSTAQTGFSSLPI 1276
                   ||||..|   ||              ||.:.|       ||.  |....|.|..:|  
  Fly  1213 -------QIPVQMQ---VP--------------PTSVAP-------PIQ--HTYNQQGGQVTL-- 1242

Human  1277 TMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLLQPVTQLPSQVH-------PQLL--QPAV 1332
                          |.|.....||.| .||.|....:|..||.|.|:.       .|||  |||.
  Fly  1243 --------------SDAQQQQHPGFS-AVPQQAAPFIQQPTQQPIQLSMPLEQQLQQLLHSQPAQ 1292

Human  1333 QSMGIPAN----LGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNIAPSSNVASVCIHSTVLSPPM 1393
            |...:...    |.|..::|      |.|..||.:..|.|...:..||..      |..      
  Fly  1293 QQQAMSQQQQQPLVQQQQLP------LVQQQPPLVQQQQPLVQHQQPSVQ------HQQ------ 1339

Human  1394 PTEVLATPGYFPTVVQPYVESNLLVPMGGVGGQVQVSQPGGSLAQAPTTSS---------QQAVL 1449
                       |.|.||               |.|..||.....|..|..:         ||..:
  Fly  1340 -----------PLVQQP---------------QQQQPQPQNQQPQPQTQQTHVVQQQPPQQQPAV 1378

Human  1450 ESTQGVSQVAPAEPVAVAQTQATQP---------TTLASSVDSAHSDVASGMSDGNENVPSSSGR 1505
            |.   :||::...||   |.:..||         .|.|.|::|||..:        |..|.:..:
  Fly  1379 EQ---ISQISSQVPV---QQENLQPIQVNKDANVATDAMSLNSAHGAL--------EPAPKTEPQ 1429

Human  1506 HEGRTTKRHYRKSVRSRSRHEKTSR-------PKLRILNVSNKGDRVVECQLETHNRKMVTFKFD 1563
            :.....|:..:....:||:..:.|.       |||.:.:| ::|. |:.|.:| :..|.:|||||
  Fly  1430 NSADAEKQQKQTGTGTRSQKPRRSNRSGNERIPKLSVTSV-DEGS-VINCHME-NKLKTITFKFD 1491

Human  1564 LDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADEMLSEDVSVEPEGDQGLESLQGKDDY 1628
            :...||.|||..::..|.:...:...||:.:.||:::..:                         
  Fly  1492 IGDVNPVEIANKLIAQDLLSNCQSTVFVEMINEIVDQVKQ------------------------- 1531

Human  1629 GFSGSQKLEGEFKQPIPASSMPQQIGIPTS---SLTQVVHSAGRRFIVSPVPESRLRESKVFPSE 1690
                                .|.||.|||:   ::.:|.|::..|...:.....|.|......|:
  Fly  1532 --------------------NPNQIPIPTNYRRNIEKVRHASLTRQRSTFRSHQRHRSRDETASD 1576

Human  1691 IT----DTV-AASTAQSPGMNLSHSASSLSLQQAFSELRRAQMTEGPNTAPPNFSHTGPTFPVVP 1750
            ||    .|: ...|..|.|.....|..:|:|:      .|:.::..||...|..:.:      .|
  Fly  1577 ITKMFEPTIHGVETLPSGGGGAEQSNCNLTLE------ARSHLSNIPNAKEPQLNVS------TP 1629

Human  1751 PFLSSIAGVPTTAAATAPVPATSSPPNDISTSVIQSEVTVPTEEGIAGVATSTGV-------VTS 1808
            |..:|.....:||:..||     :..||::.    ...:|..:...|...||..:       :|.
  Fly  1630 PTTTSTMSSSSTASRDAP-----NSSNDVTI----GSGSVSRKTSTASEYTSLSIDYMPDSNITP 1685

Human  1809 GGLPIPPVSESPVLSSVVSSITI----PAVVSISTTSP-SLQVP--------------TSTSEI- 1853
            .| |.||:.:..  .....|:.|    ..:.|....:| ||.:|              .|..:: 
  Fly  1686 TG-PEPPLDDGK--DKKPCSLAIARMQKLLESAGNGAPRSLNLPLNRHLKIQEDLKHTRSLDDLT 1747

Human  1854 VVSSTALYPSVTVSATSASAGGSTATPGPKPPAVVSQQAAGSTTVGATLTSVSTTTSFPSTASQL 1918
            .|..|...|:.....||.:|..:|.....||.. .|.||.|:...||.           :|..||
  Fly  1748 AVKITFDMPNKAALDTSENAQQATEAEAEKPKD-KSGQAVGNQGTGAA-----------NTLEQL 1800

Human  1919 CIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGLAFSLSAPSSSSSPGAGVSSYISQPGGLHPL 1983
            .|:|.:.|.....|..||.|.:  ::..|.::..:: ||.|.|     |...:..|::|.     
  Fly  1801 KIELENITHAHAFASAVVASIN--NRAPHQASPAMS-SLKATS-----GQPQTQEITKPN----- 1852

Human  1984 VIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVANVPAVQQTLIHSQPQPALLPNQPHTHC 2048
                         ..|||                    :||:|.|    :.|..||         
  Fly  1853 -------------NGAGP--------------------SVPSVGQ----NTPTAAL--------- 1871

Human  2049 PEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLETSLVIESTVTPGIPTTAVAPS 2113
                  |..:..|           .|:::...:|                      |..:..:..
  Fly  1872 ------TSARGSG-----------SSVYNSRRTS----------------------IDNSVGSDM 1897

Human  2114 KLLTSTTSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVSTTTSGVKPGTAPSKPPLTKAPVLPVG 2178
            .|.|:        |||. |||:.| .|:.|...|...::|          ..:..|:|.|.|   
  Fly  1898 HLHTA--------TNLE-GTVSNP-DPIPTEASVGITIAT----------GHEKQLSKQPSL--- 1939

Human  2179 TELPAGT--LPSEQLPPFPGPSL-TQSQQPLEDLD---AQLRRTLSPEMITVTSAVGPVSMAAPT 2237
             |.|:.|  |.:...||...||. :.:|..:.||:   |.||.|.:.|    .||...:|: .|.
  Fly  1940 -EKPSATSILTNNSDPPQRNPSNGSINQNSIADLEKKLAALRNTENTE----ESATATLSV-VPK 1998

Human  2238 AITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQ----VSVAADGAQKEGKNKSEDAKSVHF 2298
            .:.|......:.:|:.....|....:..||.:..:.|    :.||..|.|.:..|          
  Fly  1999 QVEEVVNPSARKISRFSVSRVQEQKTSTGVEEPAQGQLKIDLQVAGPGGQVQTNN---------- 2053

Human  2299 ESSTSESSVLSSSSPESTLVKPEPN-GITIPGIS--SDVPESAHKTTASEAKSDTGQPTKVGRFQ 2360
              |....||:  ::|...:..|..| .:.|.||.  ...|:..|:.....:.:.:|..|:.  ..
  Fly  2054 --SVQNGSVV--NTPTEVISSPIQNVPLAINGIQLMYQQPQQIHQLPGGTSTTTSGAGTQC--IV 2112

Human  2361 VTTTANKVGRFSVSKTEDKITDTKKEGPVASPPFMDLEQAVLPAVIPKKEKPELS-EPSHLNGPS 2424
            |....|:.|             |..:.|....|   .:|:|.|.:..:.::..|: .||.:|...
  Fly  2113 VPQVVNQNG-------------THVQQPSNLQP---QQQSVHPNMTQQPQQTPLNGHPSMVNTLQ 2161

Human  2425 SDPEAAFLSRDVDDGSGSPHSPHQLSSKSLPSQNLSQSLSNSFNSSYMSSDNESD---IEDEDLK 2486
            ..|                  |.|    |||.|.: ||.....|...:.|..:..   ::.:..:
  Fly  2162 QQP------------------PQQ----SLPMQTI-QSQQQQHNQMPIISQQQQQQILMQQQQQQ 2203

Human  2487 LELRRLRDKHLKEIQDLQSRQKHE-IESLYTKLGKVPPAVI------IPPAAPLSGRRRRPTKSK 2544
            ...:..:..:|...|  |:..:|: |:|...:|..:||.|:      :|...|       |.::.
  Fly  2204 GSQQGSQQFNLPGTQ--QTHPQHQFIQSQPNQLHSLPPQVVSMAQGNLPHQLP-------PMQTM 2259

Human  2545 GSK----SSRSSSLGNKSPQLSGNLSG----QSAASVLHPQQTLHPPGNIPESGQNQLLQ--PLK 2599
            |::    |.:...|..:|.....|:.|    |:.|.|..||..   .|.:|    |.|||  ||.
  Fly  2260 GAQQQMISQQQHQLQMQSHMHQQNVPGMYNQQTGARVAAPQNF---AGAVP----NHLLQQSPLM 2317

Human  2600 PS-----PSSDNLYSAFTSDGAISVPSLSAPGQGTSSTNTVGATVNSQAAQAQPPAMTSSRKGTF 2659
            .|     |....:...|.          :..|:.|....::.||        .|..:.|..:...
  Fly  2318 ASQQPAQPMQHVMQPIFN----------ATSGEVTEEPVSLAAT--------HPHLLPSDIQSDI 2364

Human  2660 TDDLHKLVDNWA----------------------RDAMNLSGRRGSKGHMNYEGPGMARKFSAPG 2702
            ..:|..||:...                      .|.:.|      |.::.||      ||..  
  Fly  2365 KHNLDSLVNQLCNTRLGTNQHQRLLLLRQRQLIEEDELRL------KHYVEYE------KFQK-- 2415

Human  2703 QLCISMTSNLGGSAPISAASATSLGHFTKSMCPPQQYGFPATPFGAQWSGT 2753
            .|..|:::|:..:|...:|:|..|         |.....||.|..:..:.|
  Fly  2416 ALRQSISTNVPANAAYYSAAAAQL---------PTNLAAPAAPSSSNPTST 2457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
WNK1XP_011519299.1 STKc_WNK1 195..483 CDD:270932 200/288 (69%)
S_TKc 226..479 CDD:214567 187/253 (74%)
OSR1_C 500..537 CDD:289010 14/37 (38%)
WnkNP_001262171.2 STKc_WNK 469..729 CDD:270885 191/260 (73%)
S_TKc 471..729 CDD:214567 189/258 (73%)
OSR1_C 754..791 CDD:289010 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92192670
eggNOG 1 0.900 E1_KOG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 510 1.000 Inparanoid score I1305
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T608643
orthoMCL 1 0.900 OOG5_127736
Panther 1 1.100 O PTHR13902
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3400
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.