DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PINK1 and Pink1

DIOPT Version :8

Sequence 1:NP_115785.1 Gene:PINK1 / 65018 HGNCID:14581 Length:581 Species:Homo sapiens
Sequence 2:NP_081156.2 Gene:Pink1 / 68943 MGIID:1916193 Length:580 Species:Mus musculus

Alignment Length:580 Identity:473/581 (81%)
Similarity:508/581 (87%) Gaps:1/581 (0%)


Human     1 MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPN 65
            |||||||||||||||||||||..|||..:|.|:|||||...||||||....|||:||.|||.||:
Mouse     1 MAVRQALGRGLQLGRALLLRFAPKPGPLFGWGKPGPAAAWGRGERPGQVVSPGAQPRPVGLPLPD 65

Human    66 RLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQA 130
            |.|||||||||||||:||||:|||.|.|||||||||||||||||||||||||.|||.||||||||
Mouse    66 RYRFFRQSVAGLAARIQRQFMVRARGGAGPCGRAVFLAFGLGLGLIEEKQAEGRRAASACQEIQA 130

Human   131 IFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRG 195
            |||||:|...||||||..||||||:|||||:|||||:|||||||||||||:||..|..||: |:|
Mouse   131 IFTQKTKRVSDPLDTRCWQGFRLEDYLIGQAIGKGCNAAVYEATMPTLPQHLEKAKHLGLI-GKG 194

Human   196 PGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRK 260
            |.....|...|:|||.|.||.||||||||||||||||||:.|||||||||||||||||||||||:
Mouse   195 PDVVLKGADGEQAPGTPTFPFAIKMMWNISAGSSSEAILSKMSQELVPASRVALAGEYGAVTYRR 259

Human   261 SKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTL 325
            |:.||||||||||||||.||||||||||||||.||||:||...:|||||||||||||||||||||
Mouse   260 SRDGPKQLAPHPNIIRVFRAFTSSVPLLPGALADYPDMLPPHYYPEGLGHGRTLFLVMKNYPCTL 324

Human   326 RQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLA 390
            ||||...|||.|||.||.||||||||||||||||||||||||||||.|.||||||||:|||||||
Mouse   325 RQYLEEQTPSSRLATMMTLQLLEGVDHLVQQGIAHRDLKSDNILVEWDSDGCPWLVISDFGCCLA 389

Human   391 DESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYG 455
            |:.:||:|||:|..|:|||||.|||||||||..||.|||||||||.|||||||||||||.|||||
Mouse   390 DQHVGLRLPFNSSSVERGGNGSLMAPEVSTAHSGPSAVIDYSKADTWAVGAIAYEIFGLANPFYG 454

Human   456 QGKAHLESRSYQEAQLPALPESVPPDVRQLVRALLQREASKRPSARVAANVLHLSLWGEHILALK 520
            ||.||||||||||||||.:||||||:.|:|||:|||||||||||||:|||||||||||||:||||
Mouse   455 QGSAHLESRSYQEAQLPEMPESVPPEARRLVRSLLQREASKRPSARLAANVLHLSLWGEHLLALK 519

Human   521 NLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAA 580
            |||||||:.||||||||||||:||.||.|||||::||||||||||.||||||||.|||||
Mouse   520 NLKLDKMIAWLLQQSAATLLADRLREKSCVETKLQMLFLANLECEALCQAALLLSSWRAA 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PINK1NP_115785.1 STKc_PINK1 162..512 CDD:270920 286/350 (82%)
Pink1NP_081156.2 STKc_PINK1 162..511 CDD:270920 286/350 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4158
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H32672
Inparanoid 1 1.050 937 1.000 Inparanoid score I6248
Isobase 1 0.950 0 Normalized mean entropy S4469
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007807
OrthoInspector 1 1.000 T2447354
orthoMCL 1 0.900 OOG5_134199
Panther 1 1.100 LDO PTHR22972
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1313.280

Return to query results.
Submit another query.