DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PINK1 and pink1

DIOPT Version :8

Sequence 1:NP_115785.1 Gene:PINK1 / 65018 HGNCID:14581 Length:581 Species:Homo sapiens
Sequence 2:NP_001008628.1 Gene:pink1 / 494085 ZFINID:ZDB-GENE-041212-53 Length:574 Species:Danio rerio

Alignment Length:604 Identity:320/605 (53%)
Similarity:394/605 (65%) Gaps:59/605 (10%)


Human     1 MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRP-GPAAGCVRGE-----RPGWAAGPGAEPRRV 59
            |:|:..|.|||:|||::.         ..||.:| |..|...|||     ||.....|..     
Zfish     1 MSVKHVLSRGLELGRSVF---------QLGLLKPAGRVAAKFRGERLRVSRPTRTVQPQT----- 51

Human    60 GLGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSA 124
              .||.|.||||.||:||||:||.....|..|......||||||||:||||||::|.|.|.:.:.
Zfish    52 --FLPGRYRFFRLSVSGLAAQLQSGAFRRVIGGGSARNRAVFLAFGVGLGLIEQEQEEDRTSAAL 114

Human   125 CQEIQAIFTQKS-KPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKST 188
            ||||||:|.:|. :..|.|..:    |:|||:|:||:.|||||:||||||..|..|. :| :|..
Zfish   115 CQEIQAVFRKKKFQSLPKPFTS----GYRLEDYVIGKQIGKGCNAAVYEAAAPFAPP-VE-SKKC 173

Human   189 GLLPGRGPGTSAPGEGQE--RAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPA------- 244
            .|:...........:.:|  |...:|:||||:||||||.|||||:|||.:||.||||:       
Zfish   174 SLVELNQKEAEDDNKKEEPLRLSASPSFPLAMKMMWNIGAGSSSDAILRSMSMELVPSCPQALRK 238

Human   245 --SRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLPSRLHPEG 307
              ..:.|.|.:|||        ||:|:.|||:|.|.||||:.|||||||..:||||||:||:|.|
Zfish   239 EQGELTLNGHFGAV--------PKRLSAHPNVITVYRAFTAEVPLLPGAREEYPDVLPTRLNPHG 295

Human   308 LGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNILVEL 372
            ||..||||||||||||||||||.|..|....|::|.||||||||||.:|.||||||||||||:|.
Zfish   296 LGSNRTLFLVMKNYPCTLRQYLEVCVPKRTQASLMFLQLLEGVDHLCRQNIAHRDLKSDNILLEF 360

Human   373 DPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAW 437
            |..|||.|||.|||||||::| ||:||||||:|:||||.||||||||||.|||..||||||||.|
Zfish   361 DNTGCPRLVITDFGCCLAEDS-GLKLPFSSWWVNRGGNSCLMAPEVSTAVPGPGVVIDYSKADVW 424

Human   438 AVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALLQREASKRPSARV 502
            ||||||||:||..||||     .||||||||.||||||.:.|.||:.:|:.||::...|||||||
Zfish   425 AVGAIAYELFGQPNPFY-----TLESRSYQEKQLPALPAAAPDDVQLVVKLLLRKNPHKRPSARV 484

Human   503 AANVLHLSLWGEHIL-ALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLANLECET 566
            |||:||:||||..:| .|..:::.:|:.||..|||..||..|..::..||.:::..||||:|.|.
Zfish   485 AANILHISLWGRRVLMGLDKVQMAEMMAWLQCQSAVVLLKGRGRDQSSVEAELQRSFLANIELED 549

Human   567 LCQAALLLC----SWRAAL 581
            |..|...:.    .||:.|
Zfish   550 LRTAVSFMTYERKQWRSLL 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PINK1NP_115785.1 STKc_PINK1 162..512 CDD:270920 223/361 (62%)
pink1NP_001008628.1 STKc_PINK1 149..494 CDD:270920 223/361 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4158
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32672
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D137670at7742
OrthoFinder 1 1.000 FOG0007807
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_134199
Panther 1 1.100 LDO PTHR22972
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 1 1.500
1010.290

Return to query results.
Submit another query.