DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PINK1 and Pink1

DIOPT Version :8

Sequence 1:NP_115785.1 Gene:PINK1 / 65018 HGNCID:14581 Length:581 Species:Homo sapiens
Sequence 2:NP_001027049.1 Gene:Pink1 / 31607 FlyBaseID:FBgn0029891 Length:721 Species:Drosophila melanogaster

Alignment Length:740 Identity:217/741 (29%)
Similarity:310/741 (42%) Gaps:199/741 (27%)


Human     1 MAVRQALGRGLQLGRALLLRFTGKPGRA-------------YGLGRPGPAAGCVRGERPGWAA-- 50
            |:||....|.::.||.:|..:..:...|             .|...|..||..:| ..|..||  
  Fly     1 MSVRLLTVRLIKHGRYILRSYCKRDIHANILDQNQLKTRSKRGFPLPSTAANVLR-TTPQQAAKS 64

Human    51 ------------------GPGAEPR------RVG-----LGLPNRL-RFFRQSVAGLAARLQRQF 85
                              |.|:.|.      |||     |.:.|.| |........|..|..|:.
  Fly    65 VVNVVPRTINSPSGSPFNGSGSSPTSSSGIFRVGQHARKLFIDNILSRVTTTYSEDLRQRATRKL 129

Human    86 VVRAWGCAGPCGRAVFLAFGLGLGLIEEKQA------ESRRAVSACQ------EIQAIFTQKSKP 138
            .   :|.:.|....:.::...|.|::.::..      |.|.|.|..|      ||.         
  Fly   130 F---FGDSAPFFALIGVSLASGSGVLSKEDELEGVCWEIREAASRLQNAWNHDEIS--------- 182

Human   139 GPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEA----TMPTLPQNLEVTKSTGLLPGRGPGT- 198
              |.||::    |.:::..||..|.|||:|.||.|    .:.:...:|.........|...|.: 
  Fly   183 --DTLDSK----FTIDDLEIGPPIAKGCAAVVYAADFKKDVASDGASLHTDAQPQATPAFAPNSW 241

Human   199 -----------------------------SAPG-----------------------------EGQ 205
                                         |.|.                             :.|
  Fly   242 STHEMMSPLQNMSRFVHNFGGSVDNVFHYSQPSAASDFVGAQSREQDQRHHEQQQHQNQEQEQHQ 306

Human   206 ERAPGAPAF-----------------PLAIKMMWNISAGSSSEAILNTMSQELVPASRVAL---A 250
            .:.|.:.||                 |||:|||:|....|::.:||..|.:|.|||.:..:   |
  Fly   307 NQEPSSSAFNVTSPANSNINSSVDSYPLALKMMFNYDIQSNALSILRAMYKETVPARQRGMNEAA 371

Human   251 GEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLF 315
            .|:..:...::...|:    ||||:.:...|...|...|...:.||...|.|::|:|.|...:|:
  Fly   372 DEWERLLQNQTVHLPR----HPNIVCMFGFFCDEVRNFPDGHLLYPVAQPQRINPQGYGRNMSLY 432

Human   316 LVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNILVELDPDGCPWL 380
            |:||.|..:||..|.....|.|...::|.|:||.|:||.:.|:|||||||||:|:||..|..|.|
  Fly   433 LLMKRYDHSLRGLLDSQDLSTRNRILLLAQMLEAVNHLSRHGVAHRDLKSDNVLIELQDDAAPVL 497

Human   381 VIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYE 445
            |::||||||||:..||:||:.|..||:|||..|||||:....|||.||::|.|||.||.||:|||
  Fly   498 VLSDFGCCLADKVHGLRLPYVSHDVDKGGNAALMAPEIFNTMPGPFAVLNYGKADLWACGALAYE 562

Human   446 IFGLVNPFY----------GQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALLQREASKRPSA 500
            |||..||||          |:....|.:..|::.|||.:.::.||.::|||..:|....|||.|.
  Fly   563 IFGNRNPFYSSSGGMARERGEMTLSLRNSDYRQDQLPPMSDACPPLLQQLVYNILNPNPSKRVSP 627

Human   501 RVAANVLHLSLWGEHILALKN-LKLDKM------VGWLLQQSAATLLANRLTEKCCVETKMKM-- 556
            .:||||:.|.||     |..| ||...|      :.|||.          ||.|...|.:.:|  
  Fly   628 DIAANVVQLFLW-----APSNWLKAGGMPNSPEILQWLLS----------LTTKIMCEGRPQMGA 677

Human   557 --LFLANLECETLCQAALLLCSWRA 579
              :.:|:..........||:||:.|
  Fly   678 GLMPVASCGNRRAYVEYLLICSFLA 702

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PINK1NP_115785.1 STKc_PINK1 162..512 CDD:270920 151/443 (34%)
Pink1NP_001027049.1 STKc_PINK1 328..639 CDD:270920 134/315 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D161355at33208
OrthoFinder 1 1.000 FOG0007807
OrthoInspector 1 1.000 T1072793
orthoMCL 1 0.900 OOG5_134199
Panther 1 1.100 LDO PTHR22972
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2724
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.