DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PINK1 and Pink1

DIOPT Version :8

Sequence 1:NP_115785.1 Gene:PINK1 / 65018 HGNCID:14581 Length:581 Species:Homo sapiens
Sequence 2:NP_001100164.1 Gene:Pink1 / 298575 RGDID:1305769 Length:257 Species:Rattus norvegicus

Alignment Length:241 Identity:189/242 (78%)
Similarity:204/242 (84%) Gaps:1/242 (0%)


Human     1 MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPN 65
            |||||||||||||||||||||..|||...|.|:|||.|...||||||..:.|||:||.:||.||:
  Rat     1 MAVRQALGRGLQLGRALLLRFAPKPGPVSGWGKPGPGAAWGRGERPGRVSSPGAQPRPLGLPLPD 65

Human    66 RLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQA 130
            |.|||||||||||||:||||||||.|.|||||||||||||||||||||||||||||.||||||||
  Rat    66 RYRFFRQSVAGLAARIQRQFVVRARGGAGPCGRAVFLAFGLGLGLIEEKQAESRRAASACQEIQA 130

Human   131 IFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRG 195
            |||||:|...|||||||.||||||:|||||:|||||:|||||||||||||:||..|..||| |:|
  Rat   131 IFTQKNKQVSDPLDTRRWQGFRLEDYLIGQAIGKGCNAAVYEATMPTLPQHLEKAKHLGLL-GKG 194

Human   196 PGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQEL 241
            |...:.|...|:||||||||.||||||||||||||||||:.|||||
  Rat   195 PDVVSKGADGEQAPGAPAFPFAIKMMWNISAGSSSEAILSKMSQEL 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PINK1NP_115785.1 STKc_PINK1 162..512 CDD:270920 60/81 (74%)
Pink1NP_001100164.1 PKc_like 162..>240 CDD:304357 59/79 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4158
HGNC 1 1.500
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32672
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D124353at32523
OrthoFinder 1 1.000 FOG0007807
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22972
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.520

Return to query results.
Submit another query.