DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PINK1 and pink-1

DIOPT Version :8

Sequence 1:NP_115785.1 Gene:PINK1 / 65018 HGNCID:14581 Length:581 Species:Homo sapiens
Sequence 2:NP_495017.1 Gene:pink-1 / 173918 WormBaseID:WBGene00017137 Length:641 Species:Caenorhabditis elegans

Alignment Length:500 Identity:158/500 (32%)
Similarity:248/500 (50%) Gaps:72/500 (14%)


Human   117 ESRRAVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQN 181
            |..|.|...:.|:.||....:...|...|....  |::.|..|:.:|:||:||||.|.:..  .:
 Worm   100 ELPRNVDLVERIRQIFGNSLRYNEDLKSTEWPN--RIDSYEFGEFLGQGCNAAVYSARLAN--SD 160

Human   182 LEVTKSTGLLPGRGPGTSAPGE-------GQERAPGAPAFPLAIKMMWNISAGSSSEA-ILNTMS 238
            .|.:.:|....|....|:...|       .|::      ||||||:|:|.......:| :|.:|.
 Worm   161 AESSGNTHYGAGFNEVTNILAEIPPVSKVAQKK------FPLAIKLMFNFEHDRDGDAHLLKSMG 219

Human   239 QELVPASRVA--LAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVL-P 300
            .||.|....|  |.|:.|  |:|...      |.|||::|:..||..|:.:||.|:..|||.| .
 Worm   220 NELAPYPNAAKLLNGQMG--TFRPLP------AKHPNVVRIQTAFIDSLKVLPDAIERYPDALHT 276

Human   301 SRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKS 365
            :|.:.......:|:::||:.|..||.:|:.....:.....:::.||||...:|.:..:|.||:||
 Worm   277 ARWYESIASEPKTMYVVMRRYRQTLHEYVWTRHRNYWTGRVIIAQLLEACTYLHKHKVAQRDMKS 341

Human   366 DNILVELD-PDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVI 429
            ||||:|.| .|..|.||:|||||.||.::  .|:.:.|..|..|||....|||::||.||....:
 Worm   342 DNILLEYDFDDEIPQLVVADFGCALACDN--WQVDYESDEVSLGGNAKTKAPEIATAVPGKNVKV 404

Human   430 DYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALLQREA 494
            ::..||.||.|.::||:....||||    ..|::.:|||::|||||..|....|.::..||:|:.
 Worm   405 NFEMADTWAAGGLSYEVLTRSNPFY----KLLDTATYQESELPALPSRVNFVARDVIFDLLKRDP 465

Human   495 SKRPSARVAANVLHLSLW--GE----------------------HILALK-NLKLDKMVGWLLQQ 534
            ::|....:|||.|:|||:  ||                      .:|:.| |.:|||::..:..:
 Worm   466 NERVKPNIAANALNLSLFRMGEDVKQMMEKCGISQMTTLLAGSSKVLSQKINSRLDKVMNLITAE 530

Human   535 SAATLLANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRA 579
            :....||..|..:  .|.:::..||:.:..|.:         ||:
 Worm   531 TIMANLAPHLISR--AERQLRATFLSRMNREDI---------WRS 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PINK1NP_115785.1 STKc_PINK1 162..512 CDD:270920 130/362 (36%)
pink-1NP_495017.1 S_TKc 137..468 CDD:214567 124/353 (35%)
STKc_PINK1 143..483 CDD:270920 130/362 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4158
Hieranoid 1 1.000
Homologene 1 1.000 H32672
Inparanoid 1 1.050 205 1.000 Inparanoid score I2727
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007807
OrthoInspector 1 1.000 T505853
orthoMCL 1 0.900 OOG5_134199
Panther 1 1.100 LDO PTHR22972
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2724
TreeFam 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.