DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SGSH and CG7402

Sequence 1:NP_000190.1 Gene:SGSH HGNCID:10818 Length:502 Species:Homo sapiens
Sequence 2:NP_649023.1 Gene:CG7402 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster

Alignment Length:575 Identity:130/576 (23%)
Similarity:210/576 (36%) Gaps:156/576 (27%)


Human    11 LLLVLGLCRARPRNALLLLADDGGFESGAYNNS-AIATPHLDALARRSLLFRNAFTSVSSCSPSR 74
            |.|..|...:...|.:::|.||.|....:::.| .|.||::||||...:|....:.. :.|:|||
  Fly    16 LSLAYGSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYVP-NLCTPSR 79

Human    75 ASLLTGLPQHQNGMYGLHQDVHHFNSF--------DKVRSLPLLLSQAGVRTGIIGKKHVG---- 127
            |:|||       |.|.:|..:.||...        .:.|.:|.:...||..|.::||.|:|    
  Fly    80 ATLLT-------GKYPIHTGMQHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGFWRK 137

Human   128 --PETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQY 190
              ..|:..||..:...||.:.....   ::::|.|.:....|.|        .|...|..:...|
  Fly   138 DLTPTMRGFDHHFGYYNGYIDYYDH---QVRMLDRNYSAGLDFR--------RDLEPCPEANGTY 191

Human   191 GTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNT-----------------PAARADLAA 238
            .|  |.|   .|...||.:...:: .||.:::.:...:|                 |..|.....
  Fly   192 AT--EAF---TSEAKRIIEQHDKS-KPLFMVLSHLAVHTGNEDSPMQAPEEEVAKFPHIRDPKRR 250

Human   239 QYT-TVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIP-----------FP-SGRTNLYWPGT 290
            .|. .:..:|:.|...:..|:|.|:||:::::..||||.|           :| .|:....|.|.
  Fly   251 TYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAGSNYPYRGQKESPWEGG 315

Human   291 A-------EPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSL 348
            .       .|||       |..|.||...:..:|..||:.....:..|       :.:.|.|.:|
  Fly   316 IRSAGALWSPLL-------KERGYVSNQAIHAVDWLPTLAGAAGVSLP-------QDLPLDGINL 366

Human   349 LPALEA--EPLWAT-------VFGSQSHHEVTMSYPM-RSVQHRHFRLVHNLNFKMPFPIDQDF- 402
            .|.|..  ||...|       |||..|:...|:.|.. .|.:.|:.:.:..|......|:.:.: 
  Fly   367 WPMLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGSSFKGRYDQWLGELETNEDDPLGESYE 431

Human   403 --YVSPTFQDLL-NR--------------TTAGQPTGWYKDLRHYYYRARWE------LYDRSRD 444
              .::...|.|| ||              |....|......|..::   :.|      .:|.::|
  Fly   432 QHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHF---KCEPLKAPCFFDLAKD 493

Human   445 PHETQNLATDPRFAQLLEMLRDQL--------------------------AKWQW 473
            |.|..|||  ..:...|:.|.|:|                          ..|:|
  Fly   494 PCERYNLA--QMYPLQLQQLADELEQIRKTAIPSARVPHSDSRANPTFHNGNWEW 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SGSHNP_000190.1 SGSH 24..472 CDD:293751 126/560 (23%)
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 110/473 (23%)
4-S 28..436 CDD:293753 105/447 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.