DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL2 and atl

DIOPT Version :8

Sequence 1:NP_001317392.1 Gene:ATL2 / 64225 HGNCID:24047 Length:584 Species:Homo sapiens
Sequence 2:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster

Alignment Length:540 Identity:294/541 (54%)
Similarity:398/541 (74%) Gaps:23/541 (4%)


Human    61 VQIVLAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNK---- 121
            ||::.|.| :|.|.|:|:||.::|:::.::|..:.||||||||||||||||||.|||||:|    
  Fly     6 VQVINASE-EHTFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHH 69

Human   122 DSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKD 186
            |:..|:||.::||.||:||||.||:||||.:|:::|:.|.|||.|:|::|:|||||||||||::|
  Fly    70 DATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRD 134

Human   187 CATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYE 251
            ||||||||||.||||:|||||||||||||||||||||||||:.:..:||||.|.||:||||:|||
  Fly   135 CATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGKKPFQRLQFLVRDWSFPYE 199

Human   252 HSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDI 316
            ..||..||.:.|::||:|...||.|||::|:||.:||:.:.|||:|||||.|||||.|||||:||
  Fly   200 AEYGALGGDKILKRRLEVSDKQHPELQSLRRHISSCFTEVACFLMPHPGLNVATNPKFDGRLQDI 264

Human   317 DEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEA 381
            ..:||..||:|||:||||:|||.|||||.:|..|||::||::|:.||:|.|||.|||||.|||||
  Fly   265 TPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRARDLIQYFQSYMNIYKGNELPEPKSMLVATAEA 329

Human   382 NNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQD 446
            |:|.|||.|::.|.:.||:||||.:||::.:.|:.:||.:|:.|:.||.:.:||||:||..:::.
  Fly   330 NHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQTEHLRVKDKALFQFAAKRKMGGEEFTEKFRK 394

Human   447 QLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLA 511
            |||.::||.:.|:..||:.||||.||||||..||....|||:||:.|.:||.:.|..||||||:|
  Fly   395 QLEDDLEEVFTNYQAHNESKNIFKAARTPAVYFACAVIMYILSGIFGLVGLYTFANFCNLVMGVA 459

Human   512 LIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQRSPRKVFSKLFEVTRRRMVHR----------- 565
            |:.|..|||::||||..:.|..:|..|..|||     |....::.....:.:|.           
  Fly   460 LLTLALWAYIRYSGELSDFGGKLDDFATLLWE-----KFMRPIYHGCMEKGIHHVATHATEMAVG 519

Human   566 --ALSSAQRQRLSSNNNKKK 583
              |.|...:..::::|.|.|
  Fly   520 GGAASYRSQTSVNASNGKVK 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATL2NP_001317392.1 GBP 70..341 CDD:280433 177/275 (64%)
atlNP_001287506.1 GBP 14..289 CDD:280433 177/275 (64%)
MSC <316..>471 CDD:286487 81/155 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C74932720
eggNOG 1 0.900 E1_KOG2037
Hieranoid 1 1.000
Homologene 1 1.000 H56949
Inparanoid 1 1.050 627 1.000 Inparanoid score I843
Isobase 1 0.950 0 Normalized mean entropy S2627
OMA 1 1.010
OrthoDB 1 1.010 D1027269at2759
OrthoFinder 1 1.000 FOG0000937
OrthoInspector 1 1.000 T609647
orthoMCL 1 0.900 OOG5_130010
Panther 1 1.100 LDO PTHR10751
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4011
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.