DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL2 and Atl2

DIOPT Version :8

Sequence 1:NP_001317392.1 Gene:ATL2 / 64225 HGNCID:24047 Length:584 Species:Homo sapiens
Sequence 2:XP_017449556.1 Gene:Atl2 / 298757 RGDID:1305125 Length:588 Species:Rattus norvegicus

Alignment Length:586 Identity:537/587 (91%)
Similarity:553/587 (94%) Gaps:4/587 (1%)


Human     1 MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVL 65
            |||||||||.|||.|||.|||:|||.|..||||||||||||:|||.|||||||||:|||||||||
  Rat     1 MAEGDEAARRQQPQQGLRRRRQTSDSSVGVNHVSSTTSLGEDYEDADLVNSDEVMRKPCPVQIVL 65

Human    66 AHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGN 130
            ||||||||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||:
  Rat    66 AHEDDHNFELDEEALERILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGS 130

Human   131 NEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALST 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   131 NEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALST 195

Human   196 MTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGK 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   196 MTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGK 260

Human   261 QFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELR 325
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   261 QFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELR 325

Human   326 NLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGA 390
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   326 NLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGA 390

Human   391 RDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEET 455
            ||.||:|||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||
  Rat   391 RDAYCRSMEQVCGGDKPYIAPSDLERKHLDLKEVALKQFRSVKKMGGDEFCRRYQDQLEAEIEET 455

Human   456 YANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAY 520
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||..||||||
  Rat   456 YANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALTSLCTWAY 520

Human   521 VKYSGEFREIGTVIDQIAETLWEQRSPRKVF----SKLFEVTRRRMVHRALSSAQRQRLSSNNNK 581
            ||||||||||||:|||:|||||||||||||.    ..|.|...|:.|..::.:....::|.:...
  Rat   521 VKYSGEFREIGTMIDQVAETLWEQRSPRKVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARL 585

Human   582 K 582
            |
  Rat   586 K 586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATL2NP_001317392.1 GBP 70..341 CDD:280433 269/271 (99%)
Atl2XP_017449556.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C361669154
eggNOG 1 0.900 E1_KOG2037
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H56949
Inparanoid 1 1.050 1142 1.000 Inparanoid score I4272
OMA 1 1.010
OrthoDB 1 1.010 D1027269at2759
OrthoFinder 1 1.000 FOG0000937
OrthoInspector 1 1.000 T2461219
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10751
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1212.460

Return to query results.
Submit another query.