DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL2 and mto1

DIOPT Version :8

Sequence 1:NP_001317392.1 Gene:ATL2 / 64225 HGNCID:24047 Length:584 Species:Homo sapiens
Sequence 2:NP_588284.1 Gene:mto1 / 2539467 PomBaseID:SPCC417.07c Length:1115 Species:Schizosaccharomyces pombe

Alignment Length:424 Identity:90/425 (21%)
Similarity:146/425 (34%) Gaps:102/425 (24%)


Human    17 LWRRRRT---SDPSAAVNHVSSTTSLGENY-----EDDDLVNSDEVMKKPCPVQIVLAHEDDHNF 73
            |.:|.:|   .:..|..:..|.|::|.|..     |.|.|...:|..|     |::...|.    
pombe   625 LQKRLQTLEEENNKAKEDSTSKTSNLLEQLKMTEAEVDSLRKENEENK-----QVIALKES---- 680

Human    74 ELDEEALEQILLQEHIRDLNIVVVSVAGAFRK---GKSFLLDFM--LRYMYNKDSQSWIGGNNEP 133
            ||.:....::||.|.|..||..:..:......   .|..|.|::  |:..:|.:..|.    |:.
pombe   681 ELVKSNDNKLLLNEQIESLNDQLSQLKTEMESVTTSKESLADYLSNLKERHNDELDSL----NKK 741

Human   134 LTGFTWRGGCERETTG-----------IQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQST---- 183
            |          ||..|           |:..|..:|..|.|...:...:|:|   ||.|.|    
pombe   742 L----------REFEGILSSNSSLKSEIEERNNQYVTLRENFDSLQNAIMET---FDKQVTHCSV 793

Human   184 ---------IKDCATVFALSTMTSSVQVYNLSQNIQE---------DDLQHLQLFTEYGR----- 225
                     :||........|.....::|:..|:::|         .:.:.|:...:..|     
pombe   794 NHLVQQIRKLKDENKKDQSGTDKLMKKIYHCEQSLKEKTNSLETLVSEKKELKNLLDAERRSKKA 858

Human   226 --LAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLE-GGKQFLEKRLQVKQNQHEELQNVRKHIHNC 287
              |.:|.:..:.|:.   .:...|.|.|.|...| ...|..||||   :.|.||..::.|:|...
pombe   859 IQLELENLSSQAFRR---NLSGSSSPSERSQSRELKLLQASEKRL---KEQVEERNSLIKNIVTR 917

Human   288 FSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDL 352
            |:.|.....|     |.||......:..:::......|.|           :|.|...|..|:.:
pombe   918 FTQLNTGSKP-----VNTNVEALTTISSMNQAVNMNFREL-----------DKSIQEFKRKCQSM 966

Human   353 VEYFKAYIKIYQGEELPHPKSMLQATAEANNLAA 386
            ...||..::...|......|.:.|.......|.|
pombe   967 EREFKTELRKLDGVLEARSKRLSQLEERVKLLGA 1000

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATL2NP_001317392.1 GBP 70..341 CDD:280433 65/317 (21%)
mto1NP_588284.1 Cnn_1N 252..319 CDD:285263
Fib_alpha 511..611 CDD:285864
Mto2_bdg 1052..1101 CDD:289572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.