DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL2 and atln-1

DIOPT Version :8

Sequence 1:NP_001317392.1 Gene:ATL2 / 64225 HGNCID:24047 Length:584 Species:Homo sapiens
Sequence 2:NP_001023492.1 Gene:atln-1 / 177059 WormBaseID:WBGene00021868 Length:573 Species:Caenorhabditis elegans

Alignment Length:525 Identity:275/526 (52%)
Similarity:378/526 (72%) Gaps:19/526 (4%)


Human    36 TTSLGENYEDDDLVNSDEV-----MKKPCPVQIVLAHED-DHNFELDEEALEQILLQEHIRDLNI 94
            ||...|:.|.....::..|     .|:|..|::|...|| ||:|||:.|.||:|||...:.|..:
 Worm     3 TTPQNEHNEHQQQQHAGHVEDVLLPKEPQAVRVVEVVEDTDHSFELNTELLEKILLDPKVADKKV 67

Human    95 VVVSVAGAFRKGKSFLLDFMLRYM------------YNKDSQSWIGGNNEPLTGFTWRGGCERET 147
            .|:.||||:||||||||:|.|||:            ...|:..|:..|: ||:||:||||.||:|
 Worm    68 AVIGVAGAYRKGKSFLLNFFLRYLTWRSKADKVMGEVELDNSQWMSPNS-PLSGFSWRGGSERDT 131

Human   148 TGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQED 212
            .||.:|:|.|::...||.::||||||||||||||||:|||||:||||||.||||:||||||||||
 Worm   132 NGILIWSEPFIMKDKNGEEIAVLLMDTQGAFDSQSTVKDCATIFALSTMISSVQIYNLSQNIQED 196

Human   213 DLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEEL 277
            |||||||||||||||:|:...||||:|:||:||||:|||..:|.:||::.|::||:|.:.||.||
 Worm   197 DLQHLQLFTEYGRLALEDSASKPFQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEVSEKQHAEL 261

Human   278 QNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEI 342
            |.:|:||.:||.::.|||:|||||||||||:|||:|.||:.:|:::|..::|.||....||.|||
 Worm   262 QQLRQHIRSCFEDIRCFLMPHPGLKVATNPNFDGKLVDIENEFQQQLGVMIPRLLDSHALVHKEI 326

Human   343 SGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKP 407
            :|.|:|||:|:||||||:.|::|::||.|||||.||||||||||||.||..|.:.||:|||||.|
 Worm   327 NGQKMTCRELLEYFKAYMHIFRGQDLPEPKSMLMATAEANNLAAVASARAVYQREMEEVCGGDTP 391

Human   408 YIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAA 472
            |::.::|...|..:|.:||::||:.:||||.:|..::.::||::::|:|.|::|.|:|||:|.:.
 Worm   392 YMSTNELLEHHDRVKNIAIREFRNARKMGGVDFSMQFLERLESDLQESYENYLKVNNGKNLFKSM 456

Human   473 RTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQI 537
            |||..|..:|...||.......|||:.||.||:.|:.|.:..|..|||.:|||..||.|..:|..
 Worm   457 RTPTVLVTLMIIDYIFQEFFQLIGLDFIAGLCSSVLCLVIGALGVWAYSRYSGHLREAGGYVDDA 521

Human   538 AETLW 542
            ...:|
 Worm   522 VTYVW 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATL2NP_001317392.1 GBP 70..341 CDD:280433 166/283 (59%)
atln-1NP_001023492.1 P-loop_NTPase 43..325 CDD:304359 166/283 (59%)
GBP_C 341..>447 CDD:303769 54/106 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2037
Hieranoid 1 1.000
Homologene 1 1.000 H56949
Inparanoid 1 1.050 567 1.000 Inparanoid score I620
Isobase 1 0.950 0 Normalized mean entropy S2627
OMA 1 1.010
OrthoDB 1 1.010 D1027269at2759
OrthoFinder 1 1.000 FOG0000937
OrthoInspector 1 1.000 T389451
orthoMCL 1 0.900 OOG5_130010
Panther 1 1.100 LDO PTHR10751
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4011
TreeFam 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.