DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATL2 and atl2

DIOPT Version :8

Sequence 1:NP_001317392.1 Gene:ATL2 / 64225 HGNCID:24047 Length:584 Species:Homo sapiens
Sequence 2:XP_004914749.1 Gene:atl2 / 100379898 XenbaseID:XB-GENE-947235 Length:573 Species:Xenopus tropicalis

Alignment Length:584 Identity:475/585 (81%)
Similarity:528/585 (90%) Gaps:13/585 (2%)


Human     1 MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSLGENYEDDDLVNSD-EVMKKPCPVQIV 64
            ||||.....         |.|..|..:..:|||...   .:||.::..:||| |||:||||:|||
 Frog     1 MAEGGSLRN---------RTRFGSRSNETMNHVDYP---DDNYVEEIQLNSDTEVMEKPCPIQIV 53

Human    65 LAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGG 129
            |||||||||||||.|||.||:||||||||:||:|||||||||||||||||||:||::.|.|||||
 Frog    54 LAHEDDHNFELDETALESILMQEHIRDLNVVVLSVAGAFRKGKSFLLDFMLRFMYSQSSSSWIGG 118

Human   130 NNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALS 194
            :.||||||||||||||||||||:|:||||:::|:|:||||:||||||||||||||||||||||||
 Frog   119 DYEPLTGFTWRGGCERETTGIQIWSEVFVVEKPDGSKVAVMLMDTQGAFDSQSTIKDCATVFALS 183

Human   195 TMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGG 259
            ||||||||||||||||||||||||||||||||||||||:|||||||||||||||||||:|||:||
 Frog   184 TMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYKKPFQTLMFLIRDWSYPYEHTYGLKGG 248

Human   260 KQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKREL 324
            ..||||||||||||||||||||||||:||:|:||||||||||||||||.|||||.:||::||:||
 Frog   249 NSFLEKRLQVKQNQHEELQNVRKHIHSCFTNIGCFLLPHPGLKVATNPYFDGRLAEIDDEFKKEL 313

Human   325 RNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAG 389
            |.||||||||||||||||||||||||||:||||||||||||||||||||||||||||||:|||||
 Frog   314 RELVPLLLAPENLVEKEISGSKVTCRDLLEYFKAYIKIYQGEELPHPKSMLQATAEANNMAAVAG 378

Human   390 ARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEE 454
            |:|||.:|||||||||||||||||||||||||||..||||||||||||:||||||||||||||||
 Frog   379 AKDTYSRSMEQVCGGDKPYIAPSDLERKHLDLKESCIKQFRSVKKMGGEEFCRRYQDQLEAEIEE 443

Human   455 TYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWA 519
            :|||||||||||||||||||||||||||||||||||||||||:||||.:|||:|||||:..||||
 Frog   444 SYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGMNSIATICNLIMGLALLSFCTWA 508

Human   520 YVKYSGEFREIGTVIDQIAETLWEQRSPRKVFSKLFEVTRRRMVHRALSSAQRQRLSSNNNKKK 583
            ||||||||||:||:||||||.:||||||:|||||||||.:||:...||:||.|.|:.:|||:||
 Frog   509 YVKYSGEFRELGTLIDQIAEIIWEQRSPKKVFSKLFEVCKRRVPRVALTSALRHRIPTNNNRKK 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATL2NP_001317392.1 GBP 70..341 CDD:280433 236/271 (87%)
atl2XP_004914749.1 P-loop_NTPase 59..330 CDD:304359 236/271 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C362030890
eggNOG 1 0.900 E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H56949
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1027269at2759
OrthoFinder 1 1.000 FOG0000937
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.