DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SFRP1 and fz2

Sequence 1:NP_003003.3 Gene:SFRP1 HGNCID:10776 Length:314 Species:Homo sapiens
Sequence 2:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster

Alignment Length:133 Identity:47/134 (35%)
Similarity:70/134 (52%) Gaps:13/134 (10%)


Human    54 KPP--QCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSL 116
            |.|  :|.:|  .:.:|..:||.....||.:.|||..|...:...:.||:...|....:.||||:
  Fly    58 KDPNLRCEEI--TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSM 120

Human   117 FAPVCLD---RPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFP-EGD---VCIAMTPPNA 174
            :.|:||:   :|:..||.:||..|..|.|:||.:.|.|||.:.|:..| .||   :|  |..|:.
  Fly   121 YTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLC--MEQPSY 183

Human   175 TEA 177
            |||
  Fly   184 TEA 186

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SFRP1NP_003003.3 CRD_SFRP1 52..175 CDD:143552 44/130 (34%)
NTR_Sfrp1_like 183..306 CDD:239635
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 42/123 (34%)
Frizzled 308..618 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.