DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN9A and CCH1

DIOPT Version :8

Sequence 1:NP_001352465.1 Gene:SCN9A / 6335 HGNCID:10597 Length:1988 Species:Homo sapiens
Sequence 2:NP_011733.3 Gene:CCH1 / 853131 SGDID:S000003449 Length:2039 Species:Saccharomyces cerevisiae

Alignment Length:2002 Identity:377/2003 (19%)
Similarity:677/2003 (34%) Gaps:693/2003 (35%)


Human    69 GMVSEPLE----------------DLDPYYADKKTFIVLNKGKTIFRFNATP------------- 104
            |.|||.||                .|.|...||....|:...:.|..|....             
Yeast   258 GSVSEGLEGSINNSRKKPSPKFFHHLSPQKEDKDQTEVIEYAEDILDFETLQRKLESRPFVLYGH 322

Human   105 ALYMLSPFSPLRRISIKILVHSLFSML---------IMCTILT----NCIFMTMNNPPDWTKNVE 156
            :|.:.||.:|||....:.|:|..:|:|         |:..|.|    |.:|:...:  :||....
Yeast   323 SLGVFSPTNPLRIKIARFLLHRRYSLLYNTLLTFYAILLAIRTYNPHNVVFLYRFS--NWTDYFI 385

Human   157 YTFTGIYTFESLVKILARGF--------------------------------------------- 176
            :..:..:|...:.||:|.||                                             
Yeast   386 FILSACFTGNDIAKIIAFGFWDDSEMFKAYGREYKSILQRSGIMKLYIYLREKYGRKLIDFIIPF 450

Human   177 ---CVGEFT-----------------------------FLRDPWNWLDFVVIVFAYLTEFVNLGN 209
               ..||.|                             |.|..||.:|.|..|..:|..|:::.:
Yeast   451 RIISPGEETKYQRSSLSTSLTKPYGAKENQRPFGTPRAFARSSWNRIDLVSSVSFWLGMFLSIKS 515

Human   210 V---SALRTFR---VLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFM 268
            .   :.:|.|:   :||.|:.::|..|:.:|:..|...:.:|.:|..:.|:....|.::|:|:|.
Yeast   516 YDTKTGIRIFKPLAILRILRLVNVDTGMPSILRGLKYGIPQLVNVSSMLVYFWIFFGILGVQIFQ 580

Human   269 GNLKHKC-FRNSLENNETLESIM----NTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGY 328
            |:.:.:| :.|..:..:|.:..|    ..|:.....::.:.|.:||:.::..||     .||:..
Yeast   581 GSFRRQCVWFNPEDPTDTYQYDMQFCGGYLDPVTKRKQNYIYEDGSEGSVSKGF-----LCPQYS 640

Human   329 TCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYL 393
            .||. ..||..|..|||....:...:|.:|:.:.:.:|...|:.:......:||:|.||:.:.:|
Yeast   641 KCVS-NANPYNGRISFDNIVNSMELVFVIMSANTFTDLMYYTMDSDEMAACLFFIVCIFVLTIWL 704

Human   394 INLILAVVAMAYEEQNQANIEEAKQKELEFQQMLDRLKKEQEEAEAIAAAAAEYTSIRRSRIMGL 458
            :||::||:..::|..|    ||.|:|:..:                                   
Yeast   705 LNLLIAVLVSSFEIAN----EEYKKKKFIY----------------------------------- 730

Human   459 SESSSETSKLSSKSAKERRNRRKKKNQKKLSSGEEKGDAEKLSKSESEDSIRRKSFHLGVEGHRR 523
              .|.:|..::.......:..:.|.||.|..:..:||.|                          
Yeast   731 --GSRKTGYVARIVTGYWKYFKLKANQTKFPNWSQKGLA-------------------------- 767

Human   524 AHEKRLSTPNQSPLSIRGSLFSARRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDNESRRGSL 588
                                                    |.|..||                 :
Yeast   768 ----------------------------------------IYSHVEF-----------------I 775

Human   589 FVPHRPQERRSSNISQASRSPPMLPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVIIDKA 653
            ||                             ..:.|                             
Yeast   776 FV-----------------------------ILIIC----------------------------- 782

Human   654 TSDDSGTTNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFA 718
               |.|                               .|||:..:|..                 
Yeast   783 ---DIG-------------------------------MRASVKVSTSA----------------- 796

Human   719 HKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVF 783
                  ||:...:|             .|..|:|.:.:.:|                        
Yeast   797 ------NCNNILLK-------------TDRGISIVLFIESL------------------------ 818

Human   784 TGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEG--------LSVL---RSF 837
                 |.:||.|..|  :::......::|.:|..::||...|| |||        ||:.   |.:
Yeast   819 -----ARLVLYLPNM--WKFLTKPSYVYDFIISIITLVISCLA-VEGVLGHMYAWLSIFHISRFY 875

Human   838 RLLRVFKLAKS-WPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIND 901
            |::..|.|.|. |.      :|:.|.| .:.||:.......|:.|:: |.:    |.|.|....:
Yeast   876 RVIISFNLTKKLWK------QILSNGV-MIWNLSSFYFFFTFLVAII-MAV----YFEGVIPPEE 928

Human   902 DCTLPRWHMNDFFHSFLIVFRVLCGE-WIETMWDCME----VAGQAMCLIVYMMVMVIGNLVVLN 961
            ....| :.|....:|||.:|.:...| |.:.::...:    ::....|.:.:::..::.|.|:||
Yeast   929 MADQP-FGMYSLPNSFLSLFIIGSTENWTDILYALQKHSPNISSTFFCSVFFIIWFLLSNSVILN 992

Human   962 LFLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQ 1026
            :|:||:     |:::...||:.....::          :|:|     |:.      |:..:|...
Yeast   993 IFIALI-----SESMEVKEEEKRPQQIK----------HYLK-----FVY------PQKIQEYTH 1031

Human  1027 AEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHNPS------- 1084
            |..:...::.:...|...:......||.....|    .::.:::.|.:|  .|...||       
Yeast  1032 ASLVARIRKKFFGGHRNEDTRDFKQFLMRGTAI----MNIAQNMGELAD--EFKEPPSENLFKKG 1090

Human  1085 ---LTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPG-----EGEEA 1141
               ||:.||           :.:.|...:::.:.|      :|....|..|.:.|     |..|.
Yeast  1091 LSKLTIGVP-----------SLKRLRMFANNPFYK------NSDVVFTETNDINGRTYILELNEY 1138

Human  1142 EAEPMNSDEPEACFTDGCVW-----RFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLM 1201
            |.|.::..:....|.....:     ||                  |:.|.::|..|..:.     
Yeast  1139 EDEKLDYLKKYPLFNYSYYFFSPQHRF------------------RRFCQRLVPPSTGKR----- 1180

Human  1202 ILLSSGALAFED-------------------IYIERKKTIKIIL--------------------- 1226
               :.|:..|||                   ::|....||.:|:                     
Yeast  1181 ---TDGSRFFEDSTDLYNKRSYFHHIERDVFVFIFALATILLIVCSCYVTPLYRMHHKMGTWNWS 1242

Human  1227 EYADKIFTYIFILEMLLKWIAYGY----KTYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIK 1287
            ...|..|...|.:|.::|.:|.|:    ..|..|.|.::||.::....:.|:|......:|..| 
Yeast  1243 SALDCAFIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFIDFCVLISMWINLIAYLKNNGNLSRI- 1306

Human  1288 SLRTLRALRPLRALSRFEGMRVVVN-ALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECI 1351
             .:.|.|||.||.|:.....|...| .:...:..|....|:.|.....|::.|:::|.|:...| 
Yeast  1307 -FKGLTALRALRCLTISNTARQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRLGTC- 1369

Human  1352 NTTDGSRFPASQVPNRSECFALMNVSQN--VRWKNLK--------VNFDNVGLGYLSLLQVATFK 1406
              .|||.       .|::|:   |...|  .:|..:.        ::.|:....:.||.|:.:.:
Yeast  1370 --NDGSL-------GRADCY---NEYSNSVFQWDIMSPRVYQQPYLHLDSFASAFSSLYQIISLE 1422

Human  1407 GWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQD 1471
            ||..::...::|..:........|....::.|:|......|.||||:..|::|   |.:..|  .
Yeast  1423 GWVDLLENMMNSSGIGTPATVMGSAGNALFLVLFNFLSMVFILNLFVSFIVNN---QARTTG--S 1482

Human  1472 IFMTEEQKKYYNAMKKLGSKKPQKPIPR--PGNKIQGCIFDLVT---NQAFDISIMVLICLNMVT 1531
            .:.|.|:|.:..:.|.|...|| |.||.  ..::::...:.|..   |..:...:.|::.|:::.
Yeast  1483 AYFTIEEKAWLESQKLLSQAKP-KAIPNLIELSRVRQFFYQLAVEKKNFYYASFLQVVLYLHIIM 1546

Human  1532 MMVEKEGQSQHMTEVLYWINVVFIILFTGECVLKLISLR------HYYFTVGWNIFDFVVVIISI 1590
            ::    .:|.:...::.:..|.|  :|:....|...:|.      ..||...||.....::||:.
Yeast  1547 LL----SRSYNPGNLIGYQGVYF--MFSTSVFLIQEALHMCGEGPRLYFRQKWNSIRLSIIIIAF 1605

Human  1591 V-------------------GMFLADLIETYFVSP---TLFRVIRLARIGRILRLVKGAKGIRTL 1633
            :                   |.||  |:...|:.|   ||..::..|                  
Yeast  1606 IMNAVAFHVPASHYWFHNIKGFFL--LVIFLFIIPQNDTLTELLETA------------------ 1650

Human  1634 LFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFNFETFGNSMICLFQITTSA 1698
                |.|||.:.::.....::..:|||.....|...:......|..||.|...|||.||:.:...
Yeast  1651 ----MASLPPILSLTYTWGVLFLVYAIALNQIFGLTRLGSNTTDNINFRTVIKSMIVLFRCSFGE 1711

Human  1699 GWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENF 1763
            ||:.::|.:..|: |.|.    ...:|...|||:.:......:|:.|||..:.|||::::|:.||
Yeast  1712 GWNYIMADLTVSE-PYCS----SDDNSTYTDCGSETYAYLLLMSWNIISMYIFVNMFVSLIIGNF 1771

Human  1764 SVATEE--STEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPL 1813
            |.....  |...::..:.:.:.|.|.|||.|.|..:|.|.|.....:.|.||
Yeast  1772 SYVYRSGGSRSGINRSEIKKYIEAWSKFDTDGTGELELSYLPRIMHSFDGPL 1823

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN9ANP_001352465.1 I. {ECO:0000305} 112..410 85/399 (21%)
Ion_trans 125..410 CDD:306908 81/386 (21%)
Na_trans_cytopl 488..681 CDD:314757 12/193 (6%)
II. {ECO:0000305} 726..989 58/280 (21%)
Ion_trans 743..956 CDD:306908 46/230 (20%)
Na_trans_assoc 982..1187 CDD:310839 34/225 (15%)
III. {ECO:0000305} 1180..1488 76/363 (21%)
Ion_trans 1191..1466 CDD:306908 68/330 (21%)
Na_channel_gate 1458..1510 CDD:240441 13/54 (24%)
IV. {ECO:0000305} 1497..1795 73/333 (22%)
Ion_trans 1514..1770 CDD:306908 62/286 (22%)
GPHH 1774..1837 CDD:318993 13/41 (32%)
CCH1NP_011733.3 Ion_trans 486..722 CDD:278921 63/246 (26%)
Ion_trans 795..1010 CDD:278921 59/301 (20%)
Ion_trans 1228..1480 CDD:278921 59/270 (22%)
Ion_trans 1566..1776 CDD:278921 56/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I511
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.952 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.