DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN9A and scn1lab

DIOPT Version :8

Sequence 1:NP_001352465.1 Gene:SCN9A / 6335 HGNCID:10597 Length:1988 Species:Homo sapiens
Sequence 2:NP_001038360.2 Gene:scn1lab / 559447 ZFINID:ZDB-GENE-060906-1 Length:1996 Species:Danio rerio

Alignment Length:2013 Identity:1475/2014 (73%)
Similarity:1684/2014 (84%) Gaps:48/2014 (2%)


Human     3 MLPPPGPQSFVHFTKQSLALIEQRIAERKSKEPKEEKK--DDDEEAPKPSSDLEAGKQLPFIYGD 65
            :|.||||.||..|..:|||.|||||||..::.||.|::  ||||..|||:.||||||.|||||||
Zfish     5 LLVPPGPDSFRPFLPESLAAIEQRIAEEVAQRPKGERRPDDDDENGPKPNRDLEAGKPLPFIYGD 69

Human    66 IPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSM 130
            :||.|:|.||||||.||:::|||||||:||.|||||||||||:||||:|||||||::|||||||.
Zfish    70 VPPHMLSVPLEDLDTYYSNQKTFIVLNRGKAIFRFNATPALYILSPFNPLRRISIRVLVHSLFSF 134

Human   131 LIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVV 195
            :|||||||||.|||::|||:|.||||||||||||||||:||||||||||:|||||||||||||.|
Zfish   135 VIMCTILTNCAFMTLSNPPEWAKNVEYTFTGIYTFESLIKILARGFCVGKFTFLRDPWNWLDFSV 199

Human   196 IVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFA 260
            |:.||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish   200 ILMAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFA 264

Human   261 LIGLQLFMGNLKHKCFR----NSLEN-----NETLESIMNTLESEEDFRKYFYYLEGSKDALLCG 316
            |||||||||||:.||.:    |..:|     .|...|..|..|...|...| |::.|.:||||||
Zfish   265 LIGLQLFMGNLRQKCVKMPEVNVTDNLTDYSTELHNSTFNWTEYISDSNNY-YFIPGRRDALLCG 328

Human   317 FSTDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIF 381
            .|:|:||||||:||:|.|||||||||||||||||||:||||||||:||||||||||||||.||||
Zfish   329 NSSDAGQCPEGFTCIKAGRNPDYGYTSFDTFSWAFLSLFRLMTQDFWENLYQQTLRAAGKPYMIF 393

Human   382 FVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQKELEFQQMLDRLKKEQEEAEAIAAAAAE 446
            ||:|||||||||:|||||||||||:|||||.||||:|||.|||.||::||::||||:..||||.|
Zfish   394 FVLVIFLGSFYLVNLILAVVAMAYDEQNQATIEEAQQKEEEFQAMLEQLKRQQEEAQVAAAAATE 458

Human   447 YTSIRRSRIMGLS-ESSSETSKLSSKSAKERRNRRKKKNQKKLSSGEEKGDAEKLSKSESEDSIR 510
              |...|...||| ||||..|:|||||||||||||||:.|::   .|||.|.||..||.||||||
Zfish   459 --SGEYSGRGGLSEESSSGGSRLSSKSAKERRNRRKKRKQRE---EEEKADQEKFHKSASEDSIR 518

Human   511 RKSFHLGVEGHRRAHEKRLSTPNQSPLSIRGSLFSARRSSRTSLFSFKGRGRDIGSETEFADDEH 575
            |..|...::.:|.::||:.||||||.|||||||||.||:||.|||||:||.||.|||.:||||||
Zfish   519 RPGFRFSIDANRLSYEKKCSTPNQSLLSIRGSLFSPRRNSRASLFSFRGRARDFGSENDFADDEH 583

Human   576 SIFGDNESRRGSLFVPHRPQERRSSNISQASRSPP--MLPVNGKMHSAVDCNGVVSLVDGRSALM 638
            |.|.|::||||||||| |..|||||.:|..|.:.|  |||.|||||..||||||||||.|.|...
Zfish   584 STFEDSDSRRGSLFVP-RCVERRSSTVSHCSLTAPRIMLPANGKMHCTVDCNGVVSLVGGTSVPT 647

Human   639 LPNGQLLPEVIIDKATSDDSGTTNQIH-KKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEE 702
            .|.|:||||           |||.:.. :|:|..|:..| |.|.:...|:||||.|||||||:||
Zfish   648 SPIGRLLPE-----------GTTTESDVRKKRSGSHQPS-DYLEETVARKRAMSVASILTNTMEE 700

Human   703 LEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHP 767
            ||||||||||.||:||:.||||:|||.|:|.|:.:..||||||||||||||||||||||||||:|
Zfish   701 LEESRQKCPPCWYKFANSFLIWDCSPAWLKVKEIMNMIVMDPFVDLAITICIVLNTLFMAMEHYP 765

Human   768 MTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLS 832
            ||.:|.::|::|||||||||.|||.||:||:|||.|||.||||||.:||:|||:||.||:|||||
Zfish   766 MTTQFSHLLSVGNLVFTGIFTAEMCLKVIALDPYYYFQEGWNIFDGIIVSLSLMELGLANVEGLS 830

Human   833 VLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVC 897
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||
Zfish   831 VLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYRECVC 895

Human   898 KINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVLNL 962
            ||::.|.||||||:||||||||||||||||||||||||||||||:|||||:||||||||||||||
Zfish   896 KISESCELPRWHMDDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLIVFMMVMVIGNLVVLNL 960

Human   963 FLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKAF--SKKPKISREIR 1025
            ||||||||||:|||.|.::|.:.|||||||.||:|||..||.|||:|:...|  ..||:...|.:
Zfish   961 FLALLLSSFSADNLAATDDDSEMNNLQIAVGRIQKGIALVKSTLRQFLQSLFLAGSKPRSLDEEK 1025

Human  1026 QAEDLNTK-KENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHL---MEDSDGQSFIHNPSLT 1086
            ..:||::. |||.:|||....:....::|||.....|.|  |:.|:   :|:.|..|||||||||
Zfish  1026 PLDDLHSDGKENCLSNHAPVAVDLTKDYLKEGCVSPGNG--VESHVKYGIEEGDYMSFIHNPSLT 1088

Human  1087 VTVPIAPGESDLENMNAEELSSD-SDSEYSKVRL---NRSSSSECSTVDNPLPGEG-EEAEAEPM 1146
            ||||||.||||.||:|.|:.||: ||.|.||.:|   ...||||.||||...|||| |..|.||.
Zfish  1089 VTVPIAVGESDFENLNTEDFSSESSDVEGSKEKLPVDTVLSSSEGSTVDIRPPGEGAESVELEPE 1153

Human  1147 NSDEPEACFTDGCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSGALAF 1211
            .|.:||||||:|||.||.||||::|.||.|.||.:||||:.||||:||||||:.|||||||||||
Zfish  1154 ESLDPEACFTEGCVMRFQCCQVDVEKGKWKSWWILRKTCFIIVEHNWFESFIIFMILLSSGALAF 1218

Human  1212 EDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCWLDFLIVDVSLVTLVAN 1276
            ||||||::||||.:||||||:|||||||||||||:|||:..|||||||||||||||||||:||||
Zfish  1219 EDIYIEQRKTIKTVLEYADKVFTYIFILEMLLKWVAYGFAKYFTNAWCWLDFLIVDVSLVSLVAN 1283

Human  1277 TLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVN 1341
            .||||:|..|||||||||||||||||||||||||||||:||||||||||||||||||||||||||
Zfish  1284 ALGYSELSAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVN 1348

Human  1342 LFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNVRWKNLKVNFDNVGLGYLSLLQVATFK 1406
            |||||:|.|:|.|:...||.|.|.|:|:|:||:..:...||||:|:||||||.|||:||||||||
Zfish  1349 LFAGKYYYCVNITNDELFPVSVVNNKSDCYALIQNNDTARWKNVKINFDNVGAGYLALLQVATFK 1413

Human  1407 GWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQD 1471
            ||..||||||||.::::||.||.:||||:|||:||||||||||||||||||||||||||||||||
Zfish  1414 GWMDIMYAAVDSRDLEQQPVYETNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQD 1478

Human  1472 IFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEK 1536
            |||||||||||||||||||||||||||||.||.||.:|||:|.|||||.||:||||||||||||.
Zfish  1479 IFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGLVFDLITKQAFDIIIMILICLNMVTMMVET 1543

Human  1537 EGQSQHMTEVLYWINVVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIET 1601
            :.|::.|..:|||||:|||||||||||||:||||||:||:|||:|||||||:|||||||:::||.
Zfish  1544 DDQTEDMDNILYWINLVFIILFTGECVLKMISLRHYFFTIGWNVFDFVVVILSIVGMFLSEMIEK 1608

Human  1602 YFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF 1666
            ||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||
Zfish  1609 YFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNF 1673

Human  1667 AYVKKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCG 1731
            ||||:|.||:||||||||||||:||||||||||||||||||||.:.||||.:..||||...|:||
Zfish  1674 AYVKREAGIDDMFNFETFGNSMLCLFQITTSAGWDGLLAPILNKQDPDCDSEMEHPGSFYRGNCG 1738

Human  1732 NPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQF 1796
            |||||||:|||||||.||:||||||||||||||||||||.||||||||||||||||:|||:||||
Zfish  1739 NPSVGIFFFVSYIIICFLIVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWERFDPNATQF 1803

Human  1797 IEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRS 1861
            :|::||||||.||||||.||||||:|||||||||||||||||||||||||.|||||.||||:||.
Zfish  1804 VEYNKLSDFADALDPPLRIAKPNKIQLIAMDLPMVSGDRIHCLDILFAFTLRVLGEEGEMDALRG 1868

Human  1862 QMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIKD-GDRDDD 1925
            |||:|||::||||||||||||||:||||::||.|||||:||:|:||.||..|..|.|. .|....
Zfish  1869 QMEDRFMASNPSKVSYEPITTTLRRKQEEMSAVVIQRAFRRHRIRQTVKKASEAYRKQLQDGGGH 1933

Human  1926 LLNKKDMAFDNVNENSSPEKTDATSSTTSPPSYDSVTKPDKEKYEQDRTEKEDKGKDSKESKK 1988
            :..|:.:......|||:.:|||.|.|:.|||||:||.|.:|:|||::|.|||||.||:::.||
Zfish  1934 IPEKEVLVIGKFQENSASDKTDMTPSSASPPSYNSVAKSEKDKYEKERREKEDKAKDARDRKK 1996

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN9ANP_001352465.1 I. {ECO:0000305} 112..410 243/307 (79%)
Ion_trans 125..410 CDD:306908 233/294 (79%)
Na_trans_cytopl 488..681 CDD:314757 112/196 (57%)
II. {ECO:0000305} 726..989 219/263 (83%)
Ion_trans 743..956 CDD:306908 185/213 (87%)
Na_trans_assoc 982..1187 CDD:310839 113/216 (52%)
III. {ECO:0000305} 1180..1488 249/308 (81%)
Ion_trans 1191..1466 CDD:306908 220/275 (80%)
Na_channel_gate 1458..1510 CDD:240441 48/52 (92%)
IV. {ECO:0000305} 1497..1795 249/298 (84%)
Ion_trans 1514..1770 CDD:306908 215/256 (84%)
GPHH 1774..1837 CDD:318993 55/63 (87%)
scn1labNP_001038360.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D37221at33208
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126819
Panther 1 1.100 O PTHR10037
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.