DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN9A and scn1laa

DIOPT Version :8

Sequence 1:NP_001352465.1 Gene:SCN9A / 6335 HGNCID:10597 Length:1988 Species:Homo sapiens
Sequence 2:NP_956426.2 Gene:scn1laa / 393101 ZFINID:ZDB-GENE-040426-751 Length:1955 Species:Danio rerio

Alignment Length:2016 Identity:1316/2017 (65%)
Similarity:1572/2017 (78%) Gaps:98/2017 (5%)


Human     3 MLPPPGPQSFVHFTKQSLALIEQRIAERKSKEPK--EEKKDDDEEAPKPSSDLEAGKQLPFIYGD 65
            |..||||||...||::||..||.||||..:|:.|  ||:..|:|.:.||:|.|||||.||||||:
Zfish     4 MFTPPGPQSLRKFTRESLKAIESRIAEENAKKSKNTEERNKDNECSRKPNSGLEAGKTLPFIYGE 68

Human    66 IPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSM 130
            :|.|:||.||||||.:|::..||||::|.|.|:|||||||||:.|.|:.||||||:||||.||:.
Zfish    69 VPKGLVSTPLEDLDQFYSNHTTFIVVSKKKEIYRFNATPALYIFSSFNLLRRISIQILVHFLFNF 133

Human   131 LIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVV 195
            :|:||||.||.||.....|||.|||||.||||||.|:||||.|||||||.|||||||||||||:|
Zfish   134 IIICTILANCAFMVYTQTPDWAKNVEYVFTGIYTLEALVKITARGFCVGRFTFLRDPWNWLDFIV 198

Human   196 IVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFA 260
            ||.||:||||:||:|||||.||||||||||||:||||||||||||||||||||||||:|||||||
Zfish   199 IVMAYVTEFVDLGSVSALRAFRVLRALKTISVVPGLKTIVGALIQSVKKLSDVMILTLFCLSVFA 263

Human   261 LIGLQLFMGNLKHKC-----FRNSLE---NNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGF 317
            |:|||||||.||.||     |..:.|   .|:|....:|...::       |:|.|.||||:||.
Zfish   264 LVGLQLFMGILKQKCVYSTSFTENKEACYKNKTCRDYINNPSNQ-------YFLPGKKDALICGN 321

Human   318 STDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFF 382
            |:|:|||||||||:|.|:||||||||||:|.||||:||||||||:||||||||||||||||||||
Zfish   322 SSDAGQCPEGYTCLKAGKNPDYGYTSFDSFGWAFLSLFRLMTQDFWENLYQQTLRAAGKTYMIFF 386

Human   383 VVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQKELEFQQMLDRLKKEQEEAEAIAAAAAEY 447
            |:|||||||||:|||||||||||:|||||.|:||.:||.||..||:::.::::|||    |||| 
Zfish   387 VLVIFLGSFYLVNLILAVVAMAYDEQNQATIDEALKKEEEFNAMLEQITRQEQEAE----AAAE- 446

Human   448 TSIRRSRIMGLS----ESSSETSKLSSKSAKERRNRRKKKNQKKLSSGEEKGDAEKLSKSESEDS 508
                :|:..|||    :|||:.||||||||||||||:||:        :.:|::||...|..|.:
Zfish   447 ----QSKCEGLSGEKTDSSSDASKLSSKSAKERRNRKKKR--------QHQGESEKEEDSIKEGN 499

Human   509 IRRKSFHLGVEGH-RRAHEKRLSTPNQSPLSIRGSLFSARRSSRTSLFSFKGRGRDIGSETEFAD 572
            .|:.:|...|:|. ||:.::..::|.|||||.:|||.:.||.|:.|:|||:||   |.|:..:||
Zfish   500 DRKPNFTFAVDGKIRRSRDRSYTSPRQSPLSFQGSLLTPRRDSKASVFSFRGR---IHSDNNYAD 561

Human   573 DEHSIFGDNESRRGSLFVPHRPQERRSSNISQASRSPP-MLPVNGKMHSAVDCNGVVSLVDGRSA 636
            ||.|:|.:..|||.|||:|.|| ||..||:|::|.:|. :||.|||.....|.||:|.:..|.||
Zfish   562 DEQSMFEETGSRRDSLFLPTRP-ERLFSNVSKSSLTPHLLLPSNGKARYVDDSNGMVMVTSGASA 625

Human   637 LMLPNGQLL----PEVIIDKATSDDSGTTNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILT 697
               ||..::    |||...:|..||:...:...::.||:|...|:....  ::|:||:|.||...
Zfish   626 ---PNSPVIALNTPEVSRKRAMFDDTCADSDDERRSRCNSQNFSKAYRQ--SMRERALSVASGSN 685

Human   698 NTVEELEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMA 762
            |..|..|..:|:|..||:.||..:|||:|||.|::.|:.::.||||||.||.||||||:||:|||
Zfish   686 NPAECSEIFKQRCEEWWFEFAENYLIWDCSPTWLRIKEVVHMIVMDPFADLFITICIVINTVFMA 750

Human   763 MEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLAD 827
            ||.:||...:.::|:..|:||.|||.|||:.|:||:|||.||..|||||||:||||||:||.||:
Zfish   751 MECYPMDGPYSSMLSTANVVFIGIFTAEMIFKVIALDPYSYFLEGWNIFDSIIVTLSLMELCLAN 815

Human   828 V-EGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKS 891
            | .|:..||.||||||||||||||||||||||||||:|||.||||||||||||||||||||||||
Zfish   816 VLSGIGFLRPFRLLRVFKLAKSWPTLNMLIKIIGNSLGALSNLTLVLAIIVFIFAVVGMQLFGKS 880

Human   892 YKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGN 956
            |.||||||:.||.|||||||||||||||||||||||||||||||||||||.:||.|:||||||||
Zfish   881 YGECVCKISSDCMLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQPLCLTVFMMVMVIGN 945

Human   957 LVVLNLFLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKIS 1021
            ||||||||||||||||:||| |:..:.|.|||||||.||:||..::|..|:.|......:|.|  
Zfish   946 LVVLNLFLALLLSSFSADNL-AVSGEEDENNLQIAVRRIRKGFTFIKTCLQSFFRSGCLRKKK-- 1007

Human  1022 REIRQAED----LNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHN 1082
               :::.|    :|.|:....:|||..|:.|           |..|:.:      |||.::||.|
Zfish  1008 ---QKSADGNMIVNCKERKDSTNHTTIELVK-----------STGGTDL------DSDTENFISN 1052

Human  1083 PSLTVTVPIAPGESDLENMNAEELSS-DSDSEYSKVRLN--RSSSSECSTVD-NPLPGEGEEAEA 1143
            |||||:||||..|||.|.:|.|:.|| .||.|..|.:|:  .||.||.|||| .||..:||:| .
Zfish  1053 PSLTVSVPIAAEESDFECLNTEDFSSLSSDLEEDKEKLSDVASSFSEGSTVDLRPLGKDGEDA-L 1116

Human  1144 EPMNSDE--PEACFTDGCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSS 1206
            |.:..:|  ||.|||.|||.||.||||:.|.|..|.||.:|:|||.||||||||:|||.||||||
Zfish  1117 ELVLEEEAYPEPCFTAGCVRRFRCCQVDEEKGIWKKWWLLRQTCYNIVEHSWFETFIVFMILLSS 1181

Human  1207 GALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCWLDFLIVDVSLV 1271
            |||||||||::.:|::|.|||:|||:|||||||||||||:|||:..||||.||||||:||||||:
Zfish  1182 GALAFEDIYLDTRKSVKTILEFADKVFTYIFILEMLLKWVAYGFAKYFTNLWCWLDFVIVDVSLI 1246

Human  1272 TLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFS 1336
            :||||.|.||:|..|||||||||.|||||||||:|||||||||:|||||||||||||||||||||
Zfish  1247 SLVANALNYSELSAIKSLRTLRAFRPLRALSRFDGMRVVVNALLGAIPSIMNVLLVCLIFWLIFS 1311

Human  1337 IMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNVRWKNLKVNFDNVGLGYLSLLQ 1401
            |:|||.|||||.||||.|...|.|.|:|.|:::|   ..:.:.|||:|:.:||||||.|||:|||
Zfish  1312 IVGVNFFAGKFSECINITTEQRLPVSEVYNKTDC---ERMGKGVRWRNVIINFDNVGNGYLALLQ 1373

Human  1402 VATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKK 1466
            |||||||..||||||||.|.::||:||.:||||:|||:|||.|:|||||||||||||||||||||
Zfish  1374 VATFKGWMPIMYAAVDSRNPEEQPEYEVNLYMYLYFVIFIILGAFFTLNLFIGVIIDNFNQQKKK 1438

Human  1467 LGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVT 1531
            .|||||||||||||||||||||||||||||||||.|||||.||||||.|||||.|||||.|||||
Zfish  1439 FGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPKNKIQGLIFDLVTKQAFDIFIMVLIWLNMVT 1503

Human  1532 MMVEKEGQSQHMTEVLYWINVVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLA 1596
            ||:|.|.||..||..||||||:||:|||.|||||:|:||||:||||||:|||:|||:|||||.|.
Zfish  1504 MMLETEDQSIEMTRALYWINVIFIVLFTTECVLKMIALRHYFFTVGWNVFDFIVVILSIVGMSLT 1568

Human  1597 DLIETYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIF 1661
            ::|:.||||||||||||||||||:|||::.|||||||||||||||||||||||||||||||||||
Zfish  1569 EVIKKYFVSPTLFRVIRLARIGRVLRLIRSAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIF 1633

Human  1662 GMSNFAYVKKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSV 1726
            ||||||||||..||:||||||||.|||:||||||||.||||||||:||||||||||.|...||||
Zfish  1634 GMSNFAYVKKTAGIDDMFNFETFPNSMLCLFQITTSGGWDGLLAPMLNSKPPDCDPTKNFTGSSV 1698

Human  1727 EGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDP 1791
            .|||||||:|||:|||||||.||:||||||||||||||||||||.||||||||:.||||||||||
Zfish  1699 VGDCGNPSIGIFFFVSYIIICFLIVVNMYIAVILENFSVATEESAEPLSEDDFDRFYEVWEKFDP 1763

Human  1792 DATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEM 1856
            .||||:|:.||||||.:|||||.|.|||:.||::||||||:||||||||||||||||||||.|||
Zfish  1764 KATQFMEYGKLSDFADSLDPPLRIPKPNRFQLMSMDLPMVTGDRIHCLDILFAFTKRVLGEGGEM 1828

Human  1857 DSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIKDGD 1921
            |.|..|||:|||.:||||.|||||||||:||.||:||.|||||:|::.:|.::|.:.:...|:..
Zfish  1829 DMLHGQMEDRFMQSNPSKSSYEPITTTLRRKHEDMSAAVIQRAFRKHLVRDSMKKVRNFKKKNKH 1893

Human  1922 RDDDLLNKKDMAFDNVNENSSPEKTDATSSTTSPPSYDSVTKPDKEKYEQDRTEKE--DKGKDSK 1984
            ::..:.:.:.|..|..||:|     |||::|:|||||.|:|:..|.|||:|:.|||  |||...|
Zfish  1894 QNGKVPSNQSMDKDMCNEDS-----DATAATSSPPSYSSITENAKNKYEKDKHEKEVGDKGNQVK 1953

Human  1985 E 1985
            :
Zfish  1954 K 1954

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN9ANP_001352465.1 I. {ECO:0000305} 112..410 226/306 (74%)
Ion_trans 125..410 CDD:306908 216/293 (74%)
Na_trans_cytopl 488..681 CDD:314757 77/199 (39%)
II. {ECO:0000305} 726..989 201/264 (76%)
Ion_trans 743..956 CDD:306908 168/214 (79%)
Na_trans_assoc 982..1187 CDD:310839 93/215 (43%)
III. {ECO:0000305} 1180..1488 234/308 (76%)
Ion_trans 1191..1466 CDD:306908 206/275 (75%)
Na_channel_gate 1458..1510 CDD:240441 49/52 (94%)
IV. {ECO:0000305} 1497..1795 247/298 (83%)
Ion_trans 1514..1770 CDD:306908 211/256 (82%)
GPHH 1774..1837 CDD:318993 48/63 (76%)
scn1laaNP_956426.2 Ion_trans 150..416 CDD:278921 206/273 (75%)
Na_trans_cytopl 483..594 CDD:288761 51/115 (44%)
Ion_trans 749..945 CDD:278921 154/196 (79%)
Na_trans_assoc 972..1161 CDD:284034 92/212 (43%)
Ion_trans 1184..1438 CDD:278921 190/257 (74%)
Na_channel_gate 1430..1482 CDD:240441 49/52 (94%)
Ion_trans 1504..1742 CDD:278921 196/238 (82%)
GPHH 1752..1801 CDD:293510 35/49 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D37221at33208
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126819
Panther 1 1.100 O PTHR10037
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.