DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN9A and para

DIOPT Version :8

Sequence 1:NP_001352465.1 Gene:SCN9A / 6335 HGNCID:10597 Length:1988 Species:Homo sapiens
Sequence 2:NP_001259619.1 Gene:para / 32619 FlyBaseID:FBgn0285944 Length:2145 Species:Drosophila melanogaster

Alignment Length:2123 Identity:945/2124 (44%)
Similarity:1313/2124 (62%) Gaps:221/2124 (10%)


Human    12 FVHFTKQSLALIEQRIAERKSKEPKEEKK----------------------DDDEEAPKPSSDLE 54
            |..||::||..||||||....|:.:.|:|                      :|::|.|:|...||
  Fly    16 FRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEVPQYGRKKKQKEIRYDDEDEDEGPQPDPTLE 80

Human    55 AGKQLPF-IYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRI 118
            .|..:|. :.|..||.:.|.||||:||||::..||:|::|||.||||:|:.|::||.||:|:||:
  Fly    81 QGVPIPVRLQGSFPPELASTPLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRV 145

Human   119 SIKILVHSLFSMLIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFTF 183
            :|.||||.|||:.|:.|||.|||.|.|...|. .::.|..|||||||||.||::||||.:..||:
  Fly   146 AIYILVHPLFSLFIITTILVNCILMIMPTTPT-VESTEVIFTGIYTFESAVKVMARGFILCPFTY 209

Human   184 LRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDV 248
            |||.|||||||||..||:|..::|||::|||||||||||||::::|||||||||:|:|||.|.||
  Fly   210 LRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDV 274

Human   249 MILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEE-DFR----KYFYYLEG 308
            :|||:|.||||||:|||::||.|..||.:..     .|:.....|..|. |:.    ..:|..:.
  Fly   275 IILTMFSLSVFALMGLQIYMGVLTQKCIKKF-----PLDGSWGNLTDENWDYHNRNSSNWYSEDE 334

Human   309 SKDALLCGFSTDSGQCPEGYTCVK-IGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLR 372
            .....|||..:.:|||.:.|.|:: .|.||:|||||||:|.||||:.|||||||:||:|||..||
  Fly   335 GISFPLCGNISGAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLR 399

Human   373 AAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEE-QNQANIEEAKQKELEFQQMLDRLKKEQEE 436
            |||..:|:||:|:||||||||:|||||:|||:|:| |.:|..|||.::|         ..:|.||
  Fly   400 AAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEE---------AIREAEE 455

Human   437 AEAIAAAAAEYTSIRRSRIMGLSESSSETSKLSSKSAKERRNRRKKKNQKKLSSGEEKG----DA 497
            |.|..||..|..:..::: .....:::|.:.|..:.||   :........:|..|.|||    :.
  Fly   456 AAAAKAAKLEERANAQAQ-AAADAAAAEEAALHPEMAK---SPTYSCISYELFVGGEKGNDDNNK 516

Human   498 EKLS------KSESEDSIRRKSFHLGVEGHRRAHEKRLSTPNQSPLSIRGSLFSARRSSRTS-LF 555
            ||:|      :|||...|:|:.  .....|:....:::||   :.||:.||.|:.||.||:| .:
  Fly   517 EKMSIRSVEVESESVSVIQRQP--APTTAHQATKVRKVST---TSLSLPGSPFNIRRGSRSSHKY 576

Human   556 SFK-GRGR-----------------DIGSETEFADDEHSIFGDNESRRGSLFVP---------HR 593
            :.: ||||                 |......:|||.:::...:| ..|::.||         |.
  Fly   577 TIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE-ENGAIIVPVYYGNLGSRHS 640

Human   594 PQERRSSNISQASRSPPM--LPVNG--------KMHSAVDCNGVVSLVDGRSALMLPNGQL-LPE 647
            ......|.||..|....:  :.|.|        |:.:....|..|...:|.:..:..|.:| ..:
  Fly   641 SYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLDHRD 705

Human   648 VIIDKATSDDSGT----TNQIHKKRRCSSYLLSED--MLND-----PNLRQRAMSR-ASILTNTV 700
            ..|....:|::|.    .|...:..:..:.:..:|  :|||     .....||..| .|:.....
  Fly   706 YEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPT 770

Human   701 EELEES----RQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFM 761
            |:.:|.    :.|......:....|.:|:|...|:||::.:..||.||||:|.||:|||:||:||
  Fly   771 EDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFM 835

Human   762 AMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLA 826
            ||:||.|.:|.:.||..||..||..||.|..:||:||.|..|||.||||||.:||.|||:||.|.
  Fly   836 AMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE 900

Human   827 DVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKS 891
            .|:||||||||||||||||||||||||:||.|:|.::|||||||.||.||:|||||:|||||||:
  Fly   901 GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKN 965

Human   892 YKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGN 956
            |.:...:..|. .||||:..||.|||:||||||||||||:|||||.| |...|:..::..:||||
  Fly   966 YHDHKDRFPDG-DLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV-GDVSCIPFFLATVVIGN 1028

Human   957 LVVLNLFLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLRE-FILKAFSKKPKI 1020
            |||||||||||||:|.|.:|:|...|.|.|.:..|..||.:..::||:.:.: |.|    .:.|:
  Fly  1029 LVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKL----IRNKL 1089

Human  1021 SREIRQAEDLNTKKENYIS---------------NHTLAEMSKGHNFLKEKDKISGFGSSVDKHL 1070
            :.:|  ::..:.::.|.||               .|...|:..||      |:|...| .:.|.:
  Fly  1090 TNQI--SDQPSGERTNQISWIWSEGKGVCRCISAEHGDNELELGH------DEILADG-LIKKGI 1145

Human  1071 MEDS-------DGQSF-IH------NPSLTVTVPIAPGESDLENMNA---------EELSSDSDS 1112
            .|.:       ||..| ||      .|..:..:..|. :.|..::|:         ::.|....:
  Fly  1146 KEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNAT-DDDTASINSYGSHKNRPFKDESHKGSA 1209

Human  1113 EYSKVRLNRSSSSECSTVDNPLPGEGEEAEAEPMNSD-------------EPEACFTDGCVWRFS 1164
            |..:....|.:|.|...:|..|..|| |.|..|::.|             .|..|..|....:|.
  Fly  1210 ETMEGEEKRDASKEDLGLDEELDEEG-ECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP 1273

Human  1165 CCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYA 1229
            ....:.:|...:.|.|:|...::::|:.:||:.::.|||:||.|||.||:::.::..::.||.|.
  Fly  1274 ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYM 1338

Human  1230 DKIFTYIFILEMLLKWIAYGYKTYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRA 1294
            |:|||.||.||||:||:|.|:|.|||||||||||:||.|||:..||:.:|...:...|::|||||
  Fly  1339 DRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRA 1403

Human  1295 LRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRF 1359
            ||||||:||.:|||||||||:.|||||.|||||||||||||:||||.|||||:::| ...:|::.
  Fly  1404 LRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKC-EDMNGTKL 1467

Human  1360 PASQVPNRSECFALMNVSQNVRWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQ 1424
            ....:|||:.|     .|:|..|.|..:|||:||..||.|.||||||||..||..|:||..||||
  Fly  1468 SHEIIPNRNAC-----ESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQ 1527

Human  1425 PKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQ-DIFMTEEQKKYYNAMKKL 1488
            |..|.::|||:|||.||||||||||||||||||||||:||||.||. ::||||:||||||||||:
  Fly  1528 PIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKM 1592

Human  1489 GSKKPQKPIPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVV 1553
            |||||.|.||||..:.|..:|::||::.|||.||:.|.|||.||.:::...|.....||.::|.:
  Fly  1593 GSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAI 1657

Human  1554 FIILFTGECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIG 1618
            |:::|:.||:||:.:||::||...||:||.||||:||:|:.|:|:||.|||||||.||:|:|::|
  Fly  1658 FVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVG 1722

Human  1619 RILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFNFET 1683
            |:|||||||||||||||||.|||||||||.|||||||||:||||||.|.:||::.||||::||:|
  Fly  1723 RVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKT 1787

Human  1684 FGNSMICLFQITTSAGWDGLLAPILNSK---PPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYII 1745
            ||.|||.|||::|||||||:|..|:|.:   |||.|  |.:|     |:||:.:|||.:.:||::
  Fly  1788 FGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND--KGYP-----GNCGSATVGITFLLSYLV 1845

Human  1746 ISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALD 1810
            ||||:|:||||||||||:|.|||:..|.|::||::|:||:|::|||:.||:|.:.:||:|...|:
  Fly  1846 ISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLE 1910

Human  1811 PPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKV 1875
            |||.|.||||.::|:||:|:..||.::|:|||.|.||......|.......::.|  ::|.|...
  Fly  1911 PPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGE--IAARPDTE 1973

Human  1876 SYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIKDGDRDDDLLNKKDMAFDNVNEN 1940
            .|||:::||.|::|:..|.:||.|:|:::.|.............||..|.  :..|.|.|...:.
  Fly  1974 GYEPVSSTLWRQREEYCARLIQHAWRKHKARGEGGGSFEPDTDHGDGGDP--DAGDPAPDEATDG 2036

Human  1941 SSPEKTDATSSTTSPPSYDSVTKPDKEKYEQDRTEKEDKGKDS 1983
            .:|...|.:.:.|:..:.|:           |.:.....|:|:
  Fly  2037 DAPAGGDGSVNGTAEGAADA-----------DESNVNSPGEDA 2068

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN9ANP_001352465.1 I. {ECO:0000305} 112..410 173/305 (57%)
Ion_trans 125..410 CDD:306908 165/292 (57%)
Na_trans_cytopl 488..681 CDD:314757 57/248 (23%)
II. {ECO:0000305} 726..989 164/263 (62%)
Ion_trans 743..956 CDD:306908 137/213 (64%)
Na_trans_assoc 982..1187 CDD:310839 54/257 (21%)
III. {ECO:0000305} 1180..1488 187/309 (61%)
Ion_trans 1191..1466 CDD:306908 167/275 (61%)
Na_channel_gate 1458..1510 CDD:240441 36/53 (68%)
IV. {ECO:0000305} 1497..1795 175/301 (58%)
Ion_trans 1514..1770 CDD:306908 155/259 (60%)
GPHH 1774..1837 CDD:318993 31/63 (49%)
paraNP_001259619.1 Ion_trans 165..436 CDD:278921 156/277 (56%)
Na_trans_cytopl 515..648 CDD:288761 35/139 (25%)
Ion_trans 835..1028 CDD:278921 124/195 (64%)
Na_trans_assoc 1054..1296 CDD:284034 54/257 (21%)
Ion_trans 1318..1571 CDD:278921 160/259 (62%)
Na_channel_gate 1561..1613 CDD:240441 35/52 (67%)
Ion_trans 1636..1871 CDD:278921 145/242 (60%)
GPHH 1880..1930 CDD:293510 26/50 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1627 1.000 Inparanoid score I80
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D37221at33208
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 1 1.000 T608898
orthoMCL 1 0.900 OOG5_126819
Panther 1 1.100 O PTHR10037
Phylome 1 0.910 0.952 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.