DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN9A and cch1

DIOPT Version :8

Sequence 1:NP_001352465.1 Gene:SCN9A / 6335 HGNCID:10597 Length:1988 Species:Homo sapiens
Sequence 2:NP_593894.1 Gene:cch1 / 2542812 PomBaseID:SPAC6F6.01 Length:1854 Species:Schizosaccharomyces pombe

Alignment Length:2012 Identity:378/2013 (19%)
Similarity:705/2013 (35%) Gaps:680/2013 (34%)


Human    60 PFIYGDIPPGMVSEPLEDLDPYYAD--KKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKI 122
            ||::            :.|.||:..  .:.:..:.:.....|.|.||...:  ||||:.|   :|
pombe   134 PFLF------------DKLSPYFTHFFSEIYAAVLRVVGPPRANETPGRNL--PFSPILR---QI 181

Human   123 LVHSLFSMLIMCTILTNCIFMTM--NNPPDWTKNVEYTFTGI---YTFESLVKILARGFC----- 177
            ..|.|:::.|...|:.:.:.:.:  ::|.|.::.::|....|   ||.|.|:||...||.     
pombe   182 YNHPLYNIFIFVVIVLHAVLLMIRSDDPHDKSQTIDYLIIVIGILYTLEMLLKIYLFGFLYDGSS 246

Human   178 -----VGEFT--------FLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRV---LRALKTIS 226
                 :..:|        :||..||.:|||.||..::: .:........|.|.:   ||..:.::
pombe   247 SFYDFINSYTKKTPRTMSYLRHSWNRVDFVAIVALWIS-VIGKKQQGIFRLFSMIACLRLTRLLN 310

Human   227 VIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMN 291
            :....:||:.:|.:|...|..|:....|...:.|::|:|.|..:|..:|.......::.|.:   
pombe   311 ITRKTETILKSLKESSTPLVQVVSFNAFFGVMIAILGVQFFKASLNRQCVWLGDYGDQYLPT--- 372

Human   292 TLESEEDFRKYF---YYLEGSKDALLCGFSTDSGQCPEGYTCV-----KIGRNPDYGYTSFDTFS 348
                     ..|   ::..|.|.|.|......|...|.|:.|.     ::..||.....|||.|.
pombe   373 ---------GQFCGGHWENGIKRAYLDKNGFPSNVNPRGFICAEKSVCRVVENPYSNTVSFDNFF 428

Human   349 WAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANI 413
            .:...:|.:|:.:.:.::....:.|......:.|::..:..:.:|::|::|||.           
pombe   429 NSLELIFVIMSSNGFTDIMYDIMDAEYFVSCLLFIISAYFLTLWLMSLVIAVVT----------- 482

Human   414 EEAKQKELEFQQMLDRLKKEQEEAEAIAAAAAEYTSIRRSRIMGLSESSSETSKLSSKSAKERRN 478
                                                                             
pombe   483 ----------------------------------------------------------------- 482

Human   479 RRKKKNQKKLSSGEEKGDAEKLSKSESEDSIRRKSFHLGVEGHRRAHEKRLSTPNQSPLSIRGSL 543
                                                                             
pombe   483 ----------------------------------------------------------------- 482

Human   544 FSARRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDNESRRGSLFVPHRPQERRSSNISQASRS 608
                                    :.|.|.:||  |.|:            :|::|         
pombe   483 ------------------------SSFIDLQHS--GKNQ------------KEQKS--------- 500

Human   609 PPMLPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVIIDKATSDDSGTTNQIHKKRRCSSY 673
                                                     :||          .:.:.:.|..|
pombe   501 -----------------------------------------VDK----------HLIRNKLCEKY 514

Human   674 LLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIY 738
            |                                          |...|:       ||.|     
pombe   515 L------------------------------------------FYSNFI-------WISF----- 525

Human   739 FIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGN--LVFTG----IFAAEMVLKLIA 797
              ::..||    |:|               |:.:....:..|  |:|..    :.|||::|:..|
pombe   526 --IVAQFV----TLC---------------TQTYDQTSSTANRYLIFYACVDFLLAAEVILRFFA 569

Human   798 MDP-YE-YFQVGWNIFDSLIVTLSLVELFLADVEGLSV----LRSFRLLRVFKLAKSWPTLNMLI 856
            ..| |. :|:...|:.|.::..|:||.| |..:....|    |..|.:.|:::.....|....:.
pombe   570 YLPDYRLFFRRYTNLVDIVLAVLNLVTL-LPSIRKNPVAFGWLSIFAIARIYRCILLIPYTRKIA 633

Human   857 KIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF------GKSYKECVCKINDDCTLPRWHMNDFFH 915
            |::.::...|.||.|.|.|::||.::..::||      |.|        :||..    .....:.
pombe   634 KLLFSNFKQLLNLMLFLVIVLFIASLCAVRLFQDLPNDGDS--------DDDAI----SFATTYE 686

Human   916 SFLIVFRVLCGE-WIETMWDCMEVAGQAMCLIVYM---------MVMVIGNLVVLNLFLALLLSS 970
            |||.::::|..| |.:.|:     |.||....:::         :..:..|.|||::|:|::..:
pombe   687 SFLYMYQILTSENWTDVMF-----AIQARLAHLHLSWIPGAFFTLWFLFSNNVVLSMFIAVIQVN 746

Human   971 FSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTL--------------------------REF 1009
            |:..     |.|.....|::.:.|:.:..|..:.:|                          .:.
pombe   747 FAPS-----ESDLKMEQLKMYLARLLRNYNPFQASLTLNALIKRNGSRKGKTVDESHYEWLYEDN 806

Human  1010 ILKAFSKKPKISREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDS 1074
            |:|.|.:...|..:......|:|..|  :|.::||::|  :||.:...:...|..:..|.::   
pombe   807 IIKGFLRVTNIPPKEPLKPSLDTSPE--LSKYSLAKLS--NNFKRFVMRDDPFSQAYFKRVI--- 864

Human  1075 DGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGE 1139
                               |....::||.:..:.|..:..:.||:.::                |
pombe   865 -------------------GIRWEKDMNLKTAAKDMQAAKAFVRIKQT----------------E 894

Human  1140 EAEAEPMNSDEPEACFTDGCVWRFSCCQVNIESGKGKIWWNIR--KTCYKIVEHSWFESFIVLMI 1202
            ..:..|..:|..........:.||  ||..:..|..:.:..:.  :..|::::...:...:..:|
pombe   895 FLKNHPKYNDVFWVIKPSNRIRRF--CQRLVMPGVNERYGGVEPYQWVYRVIQVFIYACILTAVI 957

Human  1203 LLSSGALAFE-DIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGY----KTYFTNAWCWLD 1262
            :.......:| |..:..|:....:  :.:..|..||.:|..:|.||.|:    ..|..:.|..:|
pombe   958 IECIATPIYERDHLLNDKQHAWFV--WTEVAFATIFTIEAAIKIIADGFCITPNAYLRSTWNCID 1020

Human  1263 FLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFE-GMRVVVNALIGAIPSIMNVLL 1326
            |.::....:.|.|....::.|.  ::.|..:|||.||.::..: ..|:..:|||.....|.:..:
pombe  1021 FFVLVTLWINLYAVLTSHALLS--RAFRAFKALRVLRLINLTQTSQRMFHDALISGFFKIFSAAV 1083

Human  1327 VCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQ-------VPNRSECFALMNVSQNVRWKN 1384
            |.....:.|::...|:|.|..|.|   .|.:...|||       .||..|.:|     ..| |.|
pombe  1084 VSATLLIPFALWAKNVFGGLLYSC---NDDNVLSASQCVLEYASTPNNWEVWA-----PRV-WSN 1139

Human  1385 -LKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFT 1448
             ...:||......|:|.::|:.:||..||.:.:|....:.||:...|....::||:|.:....:.
pombe  1140 PPDYDFDRFPHALLALFEIASIEGWVDIMRSVMDITGFNNQPQTNASSGNAMFFVLFNLVSMIYI 1204

Human  1449 LNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQK-PIPRPGNKIQGCIFDLV 1512
            |.|||.:||.|:.::.     ...|.|.||:.:....:|:.|.:|.| |..||.. ::|..:|..
pombe  1205 LTLFIAIIISNYAERT-----GSAFFTAEQRAWLELRRKIKSMRPSKRPAIRPLG-LRGLCYDFA 1263

Human  1513 TNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFI---------------------- 1555
                                 |:|.|..:.....||.::::|:                      
pombe  1264 ---------------------VQKHGIWRRTFTGLYIVHLLFLLTIFYPCPIAYTYVRNSIFLIL 1307

Human  1556 -ILFTGECVLKLISLRHYYFTVG-WNIFDFVVVI------ISIVGMF----LADLIETYFVSPTL 1608
             |.:|....:|:..|..|||... ||:||.||.:      |:|:..|    |..|..|..|..|:
pombe  1308 SICYTINICVKVYGLSFYYFFHSFWNMFDVVVTLGSLTCNIAILAKFENRSLTLLQTTLLVLVTV 1372

Human  1609 FRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFI-YA-----IFGMSNFA 1667
            ..:.:.....::.:.|             :.|||::|:: :..::|::| :|     |||::.. 
pombe  1373 HLIPKFDNFDQLSKTV-------------VASLPSIFSL-IATWIVLYITFAIAFNQIFGLTKL- 1422

Human  1668 YVKKEDGIN--DMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDC 1730
                  |:|  ...||.:..|:::.||.:|...||:.::.....|. |:|    |:.......||
pombe  1423 ------GLNGGPNKNFRSIRNALVLLFTMTFGEGWNDVMHDYTISY-PNC----VNGDDFYNSDC 1476

Human  1731 GNPSVGIFYFVSYIIISFLVVVNMYIAVILENFS-VATEEST-EPLSEDDFEMFYEVWEKFDPDA 1793
            ||.......|:::.|||..:.|||:|.|:.:||| :.|:.|: ..|..:||..|.:.|..|||..
pombe  1477 GNKPWAYGLFIAWNIISMYIFVNMFITVVFDNFSYIHTKSSSFTNLQRNDFRQFKDSWAPFDPMV 1541

Human  1794 TQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDS 1858
            |.:                  |.|.|.|:.:              |.:...:..|:..:...:.|
pombe  1542 TGY------------------IPKRNAVKFV--------------LSLRGVYDFRIYRDEHTLRS 1574

Human  1859 LRSQMEERF------MSANP---SKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKN 1911
            :.|:::.:.      |..||   |:::.|.:...:    :.:...|::.       |:||.|
pombe  1575 IISKVQSKTGQQSVPMLENPLMGSEINLEALDQII----DTIDVNVVKE-------RRNVLN 1625

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN9ANP_001352465.1 I. {ECO:0000305} 112..410 73/332 (22%)
Ion_trans 125..410 CDD:306908 68/319 (21%)
Na_trans_cytopl 488..681 CDD:314757 13/193 (7%)
II. {ECO:0000305} 726..989 66/291 (23%)
Ion_trans 743..956 CDD:306908 53/241 (22%)
Na_trans_assoc 982..1187 CDD:310839 35/233 (15%)
III. {ECO:0000305} 1180..1488 77/324 (24%)
Ion_trans 1191..1466 CDD:306908 71/289 (25%)
Na_channel_gate 1458..1510 CDD:240441 13/53 (25%)
IV. {ECO:0000305} 1497..1795 83/342 (24%)
Ion_trans 1514..1770 CDD:306908 69/299 (23%)
GPHH 1774..1837 CDD:318993 13/63 (21%)
cch1NP_593894.1 Ion_trans 201..485 CDD:278921 64/462 (14%)
Ion_trans 533..748 CDD:278921 57/248 (23%)
Ion_trans 968..1220 CDD:278921 69/265 (26%)
Ion_trans 1289..1517 CDD:278921 63/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.966 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.