DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN9A and Scn9a

DIOPT Version :8

Sequence 1:NP_001352465.1 Gene:SCN9A / 6335 HGNCID:10597 Length:1988 Species:Homo sapiens
Sequence 2:NP_001277603.1 Gene:Scn9a / 20274 MGIID:107636 Length:1984 Species:Mus musculus

Alignment Length:1988 Identity:1853/1989 (93%)
Similarity:1915/1989 (96%) Gaps:4/1989 (0%)


Human     1 MAMLPPPGPQSFVHFTKQSLALIEQRIAERKSKEPKEEKKDDDEEAPKPSSDLEAGKQLPFIYGD 65
            |||||||||||||||||||||||||||:|.|:|..|:|||||:||.|||||||||||||||||||
Mouse     1 MAMLPPPGPQSFVHFTKQSLALIEQRISEEKAKGHKDEKKDDEEEGPKPSSDLEAGKQLPFIYGD 65

Human    66 IPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSM 130
            ||||||||||||||||||||||||||||||.||||||||||||||||||||||||||||||||||
Mouse    66 IPPGMVSEPLEDLDPYYADKKTFIVLNKGKAIFRFNATPALYMLSPFSPLRRISIKILVHSLFSM 130

Human   131 LIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVV 195
            |||||||||||||||:||||||||||||||||||||||:||||||||||||||||||||||||||
Mouse   131 LIMCTILTNCIFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCVGEFTFLRDPWNWLDFVV 195

Human   196 IVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFA 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   196 IVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFA 260

Human   261 LIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCP 325
            |||||||||||||||||..||.||||||||:|.||||:.::||||||||||||||||||||||||
Mouse   261 LIGLQLFMGNLKHKCFRKDLEQNETLESIMSTAESEEELKRYFYYLEGSKDALLCGFSTDSGQCP 325

Human   326 EGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGS 390
            |||.||..||||||||||||||.||||||||||||||||||||||||||||||||||||||||||
Mouse   326 EGYECVTAGRNPDYGYTSFDTFGWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGS 390

Human   391 FYLINLILAVVAMAYEEQNQANIEEAKQKELEFQQMLDRLKKEQEEAEAIAAAAAEYTSIRRSRI 455
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:.||||
Mouse   391 FYLINLILAVVAMAYEEQNQANIEEAKQKELEFQQMLDRLKKEQEEAEAIAAAAAEYTSLGRSRI 455

Human   456 MGLSESSSETSKLSSKSAKERRNRRKKKNQKKLSSGEEKGDAEKLSKSESEDSIRRKSFHLGVEG 520
            |||||||||||:||||||||||||||||.| ||||||||||.||||||.||:|||:|||||||||
Mouse   456 MGLSESSSETSRLSSKSAKERRNRRKKKKQ-KLSSGEEKGDDEKLSKSGSEESIRKKSFHLGVEG 519

Human   521 HRRAHEKRLSTPNQSPLSIRGSLFSARRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDNESRR 585
            |.||.||||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||
Mouse   520 HHRAREKRLSTPNQSPLSIRGSLFSARRSSRTSLFSFKGRGRDLGSETEFADDEHSIFGDNESRR 584

Human   586 GSLFVPHRPQERRSSNISQASRSPPMLPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVII 650
            |||||||||:|||||||||||||||:||||||||||||||||||||||.||||||||||||||||
Mouse   585 GSLFVPHRPRERRSSNISQASRSPPVLPVNGKMHSAVDCNGVVSLVDGPSALMLPNGQLLPEVII 649

Human   651 DKATSDDSGTTNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWY 715
            |||||||||||||:.|||..|||.|||||||||:|||||||||||||||||||||||||||||||
Mouse   650 DKATSDDSGTTNQMRKKRLSSSYFLSEDMLNDPHLRQRAMSRASILTNTVEELEESRQKCPPWWY 714

Human   716 RFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGN 780
            ||||.|||||||||||||||.|||||||||||||||||||||||||||||||||:|||||||:||
Mouse   715 RFAHTFLIWNCSPYWIKFKKFIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTDEFKNVLAVGN 779

Human   781 LVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKL 845
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   780 LVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVFKL 844

Human   846 AKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINDDCTLPRWHM 910
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||::|.||||||
Mouse   845 AKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINENCKLPRWHM 909

Human   911 NDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVLNLFLALLLSSFSSDN 975
            |||||||||||||||||||||||||||||||.|||||||||||||||||||||||||||||||||
Mouse   910 NDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLIVYMMVMVIGNLVVLNLFLALLLSSFSSDN 974

Human   976 LTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISN 1040
            |||||||.|||||||||.|||:|||||||||||||||:||||||.|::.::..|.|.|:||||||
Mouse   975 LTAIEEDTDANNLQIAVARIKRGINYVKQTLREFILKSFSKKPKGSKDTKRTADPNNKRENYISN 1039

Human  1041 HTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEE 1105
            .||||:||.|||||||||||||.||:||..|:::|.||||||||||||||||||||||||||.||
Mouse  1040 RTLAEISKDHNFLKEKDKISGFSSSLDKSFMDENDYQSFIHNPSLTVTVPIAPGESDLENMNTEE 1104

Human  1106 LSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEEAEAEPMNSDEPEACFTDGCVWRFSCCQVNI 1170
            |||||||:|||.|.|||||||||||||||||| |||||||:|:||||||||||||.||.||||||
Mouse  1105 LSSDSDSDYSKERRNRSSSSECSTVDNPLPGE-EEAEAEPINADEPEACFTDGCVRRFPCCQVNI 1168

Human  1171 ESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTY 1235
            :|||||:||.||||||:||||||||||||||||||||||||||||||:|||||||||||||||||
Mouse  1169 DSGKGKVWWTIRKTCYRIVEHSWFESFIVLMILLSSGALAFEDIYIEKKKTIKIILEYADKIFTY 1233

Human  1236 IFILEMLLKWIAYGYKTYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRA 1300
            ||||||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1234 IFILEMLLKWVAYGYKTYFTNAWCWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRA 1298

Human  1301 LSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVP 1365
            ||||||||||||||||||||||||||||||||||||||||||||||||||:||||||||..|||.
Mouse  1299 LSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECVNTTDGSRFSVSQVA 1363

Human  1366 NRSECFALMNVSQNVRWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYS 1430
            ||||||||||||.||||||||||||||||||||||||||||||..|||||||||||:.||.|||:
Mouse  1364 NRSECFALMNVSGNVRWKNLKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSVNVNAQPIYEYN 1428

Human  1431 LYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQK 1495
            ||||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1429 LYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQK 1493

Human  1496 PIPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTG 1560
            ||||||||.|||||||||||||||:|||||||||||||||||||:.:|:.|||||||||||||||
Mouse  1494 PIPRPGNKFQGCIFDLVTNQAFDITIMVLICLNMVTMMVEKEGQTDYMSFVLYWINVVFIILFTG 1558

Human  1561 ECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILRLVK 1625
            |||||||||||||||||||||||||||:||||||||::||.||||||||||||||||||||||:|
Mouse  1559 ECVLKLISLRHYYFTVGWNIFDFVVVILSIVGMFLAEMIEKYFVSPTLFRVIRLARIGRILRLIK 1623

Human  1626 GAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFNFETFGNSMIC 1690
            |||||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||||
Mouse  1624 GAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEAGINDMFNFETFGNSMIC 1688

Human  1691 LFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMY 1755
            ||||||||||||||||||||.||||||||||||||||||||||||||||||||||||||||||||
Mouse  1689 LFQITTSAGWDGLLAPILNSAPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMY 1753

Human  1756 IAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNK 1820
            ||||||||||||||||||||||||||||||||||||||||||||.||||||||||||||||||||
Mouse  1754 IAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNK 1818

Human  1821 VQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLK 1885
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1819 VQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLK 1883

Human  1886 RKQEDVSATVIQRAYRRYRLRQNVKNISSIYIKDGDRDDDLLNKKDMAFDNVNENSSPEKTDATS 1950
            |||||||||:|||||||||||||||||||||||||||||||.||:|:.||||||||||||||||:
Mouse  1884 RKQEDVSATIIQRAYRRYRLRQNVKNISSIYIKDGDRDDDLPNKEDIVFDNVNENSSPEKTDATA 1948

Human  1951 STTSPPSYDSVTKPDKEKYEQDRTEKEDKGKDSKESKK 1988
            ||.||||||||||||:||||.|:||||||.||  ||:|
Mouse  1949 STISPPSYDSVTKPDQEKYETDKTEKEDKEKD--ESRK 1984

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN9ANP_001352465.1 I. {ECO:0000305} 112..410 283/298 (95%)
Ion_trans 125..410 CDD:306908 270/285 (95%)
Na_trans_cytopl 488..681 CDD:314757 178/193 (92%)
II. {ECO:0000305} 726..989 255/263 (97%)
Ion_trans 743..956 CDD:306908 207/213 (97%)
Na_trans_assoc 982..1187 CDD:310839 167/205 (81%)
III. {ECO:0000305} 1180..1488 292/308 (95%)
Ion_trans 1191..1466 CDD:306908 261/275 (95%)
Na_channel_gate 1458..1510 CDD:240441 51/52 (98%)
IV. {ECO:0000305} 1497..1795 284/298 (95%)
Ion_trans 1514..1770 CDD:306908 243/256 (95%)
GPHH 1774..1837 CDD:318993 62/63 (98%)
Scn9aNP_001277603.1 I. {ECO:0000305} 112..410 283/298 (95%)
Ion_trans 147..410 CDD:278921 249/263 (95%)
Na_trans_cytopl 487..606 CDD:288761 111/119 (93%)
II. {ECO:0000305} 725..988 255/263 (97%)
Ion_trans 760..955 CDD:278921 189/195 (97%)
Na_trans_assoc 981..1185 CDD:284034 167/205 (81%)
III. {ECO:0000305} 1178..1486 292/308 (95%)
Ion_trans 1224..1464 CDD:278921 227/240 (95%)
Na_channel_gate 1456..1508 CDD:240441 51/52 (98%)
IV. {ECO:0000305} 1495..1793 284/298 (95%)
Ion_trans 1530..1768 CDD:278921 226/238 (95%)
GPHH 1780..1835 CDD:293510 54/55 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334962164
eggNOG 1 0.900 E1_KOG2301
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H2237
Inparanoid 1 1.050 3699 1.000 Inparanoid score I326
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 1 1.000 T2457288
orthoMCL 1 0.900 OOG5_126819
Panther 1 1.100 LDO PTHR10037
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R13412
TreeFam 1 0.960
1414.290

Return to query results.
Submit another query.