DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN9A and cca-1

DIOPT Version :8

Sequence 1:NP_001352465.1 Gene:SCN9A / 6335 HGNCID:10597 Length:1988 Species:Homo sapiens
Sequence 2:NP_001024497.1 Gene:cca-1 / 181045 WormBaseID:WBGene00000367 Length:1885 Species:Caenorhabditis elegans

Alignment Length:2125 Identity:510/2126 (24%)
Similarity:887/2126 (42%) Gaps:534/2126 (25%)


Human    16 TKQSLALIEQ-RIAERKSKEP-----KEEKKDDDEEAPKPSSDLEAGKQLPFIYGDIPPGMVSEP 74
            :|::|.|.|. |:|......|     ::.:..::|:       :|...:||:      ||.    
 Worm    58 SKETLQLSEHGRLASSSEASPSRWEGRQIEWGNEEQ-------IEEESELPY------PGF---- 105

Human    75 LEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTN 139
                                       |.|||.......|.|:.::::::...|..:.|..|:.|
 Worm   106 ---------------------------AEPALRCFYQARPPRKWALQMVMSPWFDRITMAVIMIN 143

Human   140 CIFMTMNNP----PDW----------TKNVEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNW 190
            |:.:.|..|    ||.          ..|..:.:   :.||.::||:|.|| .|...::.|.||.
 Worm   144 CVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVY---FAFEMVIKIMALGF-YGPAAYMSDTWNR 204

Human   191 LDFVVIVFAYLTEFV---NLG---NVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVM 249
            ||| .||.|.:.|||   .||   |::|:||.||||.|:.::.||.::.:|..|:.::..|.:|:
 Worm   205 LDF-FIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVL 268

Human   250 ILTVFCLSVFALIGLQLFMGNLKHKCFRN---SLENNETLESIMNTLESEEDFRKYFYYLEGSKD 311
            :|..|...:|.::|:||:.|.|:::|..|   ::..|::  ::.|.::...     ||..|.:..
 Worm   269 LLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQS--ALFNNVKLTR-----FYIPEDTSL 326

Human   312 ALLC------GFSTDSGQCPEGYT------------------------------CVKIGRNPDYG 340
            ..:|      |..|.|...|  ||                              |..:.|||..|
 Worm   327 EYICSQPDANGLHTCSNLPP--YTVDGVKCNLTLDEYDKVTNDSCINWNIYYNECQVMQRNPFQG 389

Human   341 YTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAY 405
            ..|||...:|::|:|.:::.:.|.::......|......|:||::|.:|:|::|||.|.|:|..:
 Worm   390 SVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQF 454

Human   406 EEQNQANIEEAKQKELEFQQMLDRLK-----------KEQEEAEAIAAAAAEYT--SIRRSRIMG 457
            .|..:...|...|   |.:.:|:|..           ..:||.:.:.||...:.  :.||::...
 Worm   455 AETKRRETERMLQ---ERKMLLNRDSISCTGSEIGGASSKEEGDTVYAAFVRFIGHTFRRTKRAA 516

Human   458 LSESSSETSKLSSKSAKERRNRRKKK--NQKKLSSGEEKGDAEK----LSKSESEDSIRRKSFHL 516
            ..:.::...:.:.:.:.||:.|||.|  :...||..|||.:.|:    :::...:|.|.:..   
 Worm   517 KKKYTAYMEERAERKSSERQQRRKSKLDDMATLSRIEEKAEDEEDETTITRENGDDQIEQNG--- 578

Human   517 GVEGHRRAHEKRLSTPNQSPLSIRGSLFSARRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDN 581
              :|.|   .||:....:..:.|                   |.|...|                
 Worm   579 --DGVR---IKRVKIEEEPKIKI-------------------GNGNSNG---------------- 603

Human   582 ESRRGSLFVPHRPQERRSSNISQASRSPPMLPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLP 646
                     ||                        ..||:.|                       
 Worm   604 ---------PH------------------------YKHSSSD----------------------- 612

Human   647 EVIIDKATSDDSGTTNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCP 711
                  ..||:.|..:|::                                    :.||:::|..
 Worm   613 ------EESDEDGEEDQVY------------------------------------DGEEAKKKST 635

Human   712 P---WWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFK 773
            |   ||:|                 :|...|::.|.|. ..|.:.|::|||.|.:|:|...|...
 Worm   636 PSKLWWFR-----------------EKIQKFVICDHFT-RGILVAILVNTLSMGVEYHQQPEILT 682

Human   774 NVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFR 838
            .:|...||.||.:||.||:||:||...:.|...|:|:||..||.||::|||.....||||||:||
 Worm   683 VILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFR 747

Human   839 LLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTL---VLAIIVFIFAVVGMQLFGKSY-------- 892
            |||:.||.:..|.|...:.::   :..:.|:|:   :|.:.:|||:::||.|||..:        
 Worm   748 LLRILKLVRFMPALRYQLVVM---LRTMDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVEEKFL 809

Human   893 ----KECV----------------------CK----------------INDDCTLPRWHMNDFFH 915
                |:|.                      ||                |:..|...|.:.::|..
 Worm   810 GGLAKKCERKNFDTLLWALITVTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFDNFLF 874

Human   916 SFLIVFRVLCGEWIETMWDCMEVAGQAM----CLIVYMMVMVIGNLVVLNLFLALLLSSFSSDNL 976
            :.:.||::|..|    .|:.:...|.|.    ..:.::.:|..||.|:.||.:|:|:..|     
 Worm   875 ATVTVFQILTQE----DWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGF----- 930

Human   977 TAIEEDPDANNLQIAVTRIKKGINYVKQTLREF-ILKAFSKKPKISREIRQAEDLNTKKENYISN 1040
               :|..:....|:.....|:.:....:..||. ::.|.:..|..:..:..||....:..:...:
 Worm   931 ---QESKEEEKRQLEEDARKQAVEEEDERKRELELIIAKTTSPAFNNGVAPAECTCQRPSSPEES 992

Human  1041 HTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLE-NMNAE 1104
            .:...:|..::...|:...:...:.:||.|:        :.|.:.....|::.|..|.. |.:|.
 Worm   993 PSPRLLSANYHPSPERKHSANLDAIIDKRLV--------LRNSAPFDRSPVSEGRDDSRLNRHAS 1049

Human  1105 -ELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEE----------------------AEAEPM 1146
             .|...:...|.:.|:: |.|..|...:...|..|..                      ||.|..
 Worm  1050 LVLPVANGVPYRRQRVH-SWSGLCHHFNPNCPVHGRRALIETYAREKFLEASQELKQALAEEEKR 1113

Human  1147 NSDEPEA----CFTDGCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSG 1207
            |..:...    .....|:...:...:.:...|..    :|..|.:..:..||:..::..|.::..
 Worm  1114 NEAKQNTFVRKLLKKTCLHNRTEFSLFLMGPKNP----LRIKCLQTTQKKWFDYTVLFFIGINCI 1174

Human  1208 ALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIA----YGYKTYFTNAWCWLDFLIVDV 1268
            .||.|...|......:..|..:..|||.||..||::|.||    .|...||.:.|..||.::|.:
 Worm  1175 TLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVI 1239

Human  1269 SLVTLVANTLGYSD----LGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCL 1329
            ||:.:....|...|    .|.|:.||.||||||||.::|..|:::||..||.::..|.|::|:|.
 Worm  1240 SLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICC 1304

Human  1330 IFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNVRWKNLKVNFDNVGL 1394
            .|::||.|:||.||.|..|.||....|:      |..:::|..    ....:|.|.:.||||:|.
 Worm  1305 TFFIIFGILGVQLFKGMMYHCIGPEVGN------VTTKADCIE----DYRNKWVNHRYNFDNLGQ 1359

Human  1395 GYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGVIIDN 1459
            ..:||..:::..||..|||..:|:|.||.||...|:.:..|||:.|::...||.||:|:||:::|
 Worm  1360 ALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVEN 1424

Human  1460 FNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQG-------------CIFDL 1511
            |::.|:.|..:    ..|::|.....:||..:|.::.:.....|::.             .:..:
 Worm  1425 FHKCKEALEKE----MREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGI 1485

Human  1512 VTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTGECVLKLISLR-HYYFT 1575
            ||::.||::|..:|.:|:::|.:|.......:..||..:|..|..:||.|..:|||:|. ..:|.
 Worm  1486 VTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFI 1550

Human  1576 VGWNIFDFVVVIISIVGMFLADLIETYF-VSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMM 1639
            ..||..|..:||:||.|:...:...... ::||:.||:|:.||.|:|:|:|.|||||:||..:..
 Worm  1551 EKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGE 1615

Human  1640 SLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKE-----DGINDMFNFETFGNSMICLFQITTSAG 1699
            :||.:.|:|.|.||:.||:|..|:..|..::..     ||:.:..:|:.||.:.:.||:|.|...
 Worm  1616 ALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDN 1680

Human  1700 WDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFS 1764
            |:|::...|..   |||... |..::.   |.:|.:...:||.:::||..|:||:.:||::::..
 Worm  1681 WNGIMKDALRD---DCDSSD-HCETNC---CVDPILAPCFFVIFVLISQFVLVNVVVAVLMKHLE 1738

Human  1765 VA----TEESTEPL----------SEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLI 1815
            .:    .|...||.          |:||     |:.|:.:|.|.:.::..:|.:.....:.|   
 Worm  1739 ESNKRDAEGPAEPTGENIENEITKSDDD-----EIVEEHEPLAIEHVKEGELDEEEETEEGP--- 1795

Human  1816 AKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSA---------- 1870
                     ...:|...|.       :...:.:||.:  |:..:...:|||:..|          
 Worm  1796 ---------TTQIPDGHGG-------IKRLSMQVLEQ--ELIEVERHLEERYRRASECLGGELQP 1842

Human  1871 -NPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISS 1914
             ||.::             ||:.....:...|.:|.|....:..|
 Worm  1843 LNPGEI-------------EDLDDPEFRPRSRSHRPRARTNSALS 1874

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN9ANP_001352465.1 I. {ECO:0000305} 112..410 97/357 (27%)
Ion_trans 125..410 CDD:306908 95/344 (28%)
Na_trans_cytopl 488..681 CDD:314757 25/197 (13%)
II. {ECO:0000305} 726..989 89/320 (28%)
Ion_trans 743..956 CDD:306908 79/270 (29%)
Na_trans_assoc 982..1187 CDD:310839 35/234 (15%)
III. {ECO:0000305} 1180..1488 107/316 (34%)
Ion_trans 1191..1466 CDD:306908 101/283 (36%)
Na_channel_gate 1458..1510 CDD:240441 10/65 (15%)
IV. {ECO:0000305} 1497..1795 97/332 (29%)
Ion_trans 1514..1770 CDD:306908 85/267 (32%)
GPHH 1774..1837 CDD:318993 11/73 (15%)
cca-1NP_001024497.1 Ion_trans 157..461 CDD:278921 88/318 (28%)
Ion_trans 670..938 CDD:278921 80/283 (28%)
Ion_trans 1176..1430 CDD:278921 98/264 (37%)
Ion_trans 1506..1721 CDD:278921 73/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.