DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN9A and unc-2

DIOPT Version :8

Sequence 1:NP_001352465.1 Gene:SCN9A / 6335 HGNCID:10597 Length:1988 Species:Homo sapiens
Sequence 2:NP_001355464.1 Gene:unc-2 / 180570 WormBaseID:WBGene00006742 Length:2171 Species:Caenorhabditis elegans

Alignment Length:1964 Identity:483/1965 (25%)
Similarity:809/1965 (41%) Gaps:503/1965 (26%)


Human    18 QSLALIEQRIAERKSKEPKEEKK---DDDEEAPKPS-------SD-----------LEAGKQLPF 61
            |..|...:|.....|:.|.....   ||:.:...|.       ||           .||.:||| 
 Worm   128 QEAASSSERGEHTNSRSPSTSYSSCIDDERKFSSPHRRRVVDVSDHKTCALLMTRMKEASRQLP- 191

Human    62 IYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNA------TPALYMLSPFSPLRRISI 120
                .|..:.:|  |......|:..||:    .||....||      ..:|::.:..:.:||.:.
 Worm   192 ----SPSQLAAE--EARREQKAESGTFV----RKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAK 246

Human   121 KILVHSLFSMLIMCTILTNCIFMTMNNP---------PDWTKNVEYTFTGIYTFESLVKILARGF 176
            .|:....|...|:.||:.||:.::|...         .:|.:..|..|.||:..|.::|::|.||
 Worm   247 AIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGF 311

Human   177 CVGEFTFLRDPWNWLDFVVIVFAYLT------------EFVNLGNVSALRTFRVLRALKTISVIP 229
            .:.:.::||..||.:||:|:|...:|            :.|:..::..||..||||.||.:|.||
 Worm   312 ALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIP 376

Human   230 GLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLE 294
            .|:.::.:::.::..|..:.:|.:|.:.:||:|||:.:.|.....|:....|.....|..|....
 Worm   377 SLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTN 441

Human   295 SEEDFRKYFYYLEGSKDALLCGFSTDSGQCP-EGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLM 358
            .......|                    .|. :|.||::....|:||.||||...:|.:.:|:.:
 Worm   442 KTSPMGVY--------------------NCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCI 486

Human   359 TQDYWENLYQQTLRAAGKTY-MIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQKE-L 421
            |.:.|..:...|..:.|.|| ..:|:.:|.||||:::||:|.|::.          |.||::| :
 Worm   487 TMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSG----------EFAKERERV 541

Human   422 EFQQMLDRLKKEQEEAEAIAA-----AAAEYTSIRRSRIMGLSESSSETSKLSSKSAKERRNRRK 481
            |.::...:|:::|:....:..     ..||...::..|       ::|..|.:...|:.|...:|
 Worm   542 ENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDR-------TTEEEKAAIMEARRRAANKK 599

Human   482 KKNQKKLSSGEEKGDAEKLSKSESEDSIRRKSFHLGVEGHRRAHEKRLSTPNQSPLSIRGSLFSA 546
            .|...|..|.|.:.|.|     |.||.:..:....|                       |::   
 Worm   600 LKQASKQQSTETEEDFE-----EDEDEMEEEYVDEG-----------------------GTV--- 633

Human   547 RRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDNESRRGSLFVPHRPQERRSSNISQASRSPPM 611
                                |.|||:         ..:||.                        
 Worm   634 --------------------EDEFAE---------RKKRGC------------------------ 645

Human   612 LPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVIIDKATSDDSGTTNQIHKKRRCSSYLLS 676
                        |:.|              |:.:.::.|            ||            
 Worm   646 ------------CHSV--------------GKFIKQLRI------------QI------------ 660

Human   677 EDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIV 741
                       |.|.:..|.                                ||           
 Worm   661 -----------RIMVKTQIF--------------------------------YW----------- 671

Human   742 MDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQV 806
                   ::...:.|||..:|.||:...:.|.:.|.....||.|||..||:|||.||....||..
 Worm   672 -------SVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFAS 729

Human   807 GWNIFDSLIVTLSLVELFLADVE----GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALG 867
            .:|.||.:::..|..|:..|:|.    |:||:|:.||||:|||...|.:|..|::.:.||:.::.
 Worm   730 KFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSII 794

Human   868 NLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGE-WIET 931
            :|..:|.:.:.|||::||||||.       :.|.....|..|.:.|..:.:.||::|.|| |.|.
 Worm   795 SLLFLLFLFILIFALLGMQLFGG-------RFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEV 852

Human   932 MWDCMEVAGQAMC----LIVYMMVMVI-GNLVVLNLFLALLLSSF-SSDNLTAIEE-DPDANNLQ 989
            |:..:|..|....    ..:|.:|:|: ||..:||:|||:.:.:. ::..|||.|| |..||.::
 Worm   853 MYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEADEKANEIE 917

Human   990 IAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISNHTLAEMSKGHNFLK 1054
                                               .::|:|:.:.:.  .:|...:|        
 Worm   918 -----------------------------------EESEELDEQYQE--GDHCTIDM-------- 937

Human  1055 EKDKISGFGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRL 1119
             :.|.:|...:|.: .|:|.|                                            
 Worm   938 -EGKTAGDMCAVAR-AMDDLD-------------------------------------------- 956

Human  1120 NRSSSSECSTVDNPLPGEGEEAEAEPMNSDEPEACFTDGCVWRFSCCQVNIESGKGKIWWNIRKT 1184
                 .||            |.|..|....:|...::.    .|.....|          ..|..
 Worm   957 -----EEC------------EEEESPFGGPKPMVPYSS----MFFLSPTN----------PFRVL 990

Human  1185 CYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYG 1249
            .:.||...:||..::.:|.|||.:||.||...|.....| :|:|.|..||.:|..|||||.|..|
 Worm   991 IHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNK-VLQYMDYCFTGVFACEMLLKLIDQG 1054

Human  1250 Y----KTYFTNAWCWLDFLIVDVSLVTL-VANTLGYS--DLGPIKSLRTLRALRPLRALSRFEGM 1307
            .    .:|..:.|..||.::|..:|... .|.|.|.:  :|..|||||.||.||||:.:.|...:
 Worm  1055 ILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKL 1119

Human  1308 RVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFA 1372
            :.|.:.::.::.::.|:|:|..:|..||:::.|.||.|||:.|   ||.:|..|:..  ..:.|.
 Worm  1120 KAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFC---TDKNRKFANTC--HGQFFV 1179

Human  1373 LMNVSQNVR-----WKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLY 1432
            ..|.:...|     |:....|:||.....|:|..|.|.:||..|...::|:...|:.|...:.:.
 Worm  1180 YDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVE 1244

Human  1433 MYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQ-KKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKP 1496
            :.:::|:|.|...||.:|:|:.:||..|.:| :.:|...|:...::|...:    .|.::.....
 Worm  1245 VALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDF----ALNARPRSLF 1305

Human  1497 IPRPGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTGE 1561
            :|...|..:..|:.|||:..|:..||.:||.|.:.:|::.........|:|...|.....:||.|
 Worm  1306 MPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVE 1370

Human  1562 CVLKLIS--LRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRILRLV 1624
            .:||:::  :|: ||..|||.||||.|:.||....:.: ...:|||   ...:||.|..|::||:
 Worm  1371 SILKILAFGVRN-YFRDGWNRFDFVTVVGSITDALVTE-FGGHFVS---LGFLRLFRAARLIRLL 1430

Human  1625 KGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFA--YVKKEDGINDMFNFETFGNS 1687
            :....||.||:..:.|..||..:.||:.::.|||||.||..|.  ::.....||...||::|.|:
 Worm  1431 QQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNA 1495

Human  1688 MICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSS----VEGD-CGNPSVGIFYFVSYIIIS 1747
            :|.||:..|..||..::...:..|  ||    ...||:    .:|. ||: :|...||.|::.:|
 Worm  1496 VILLFRCATGEGWQDIMMAAVQGK--DC----ARAGSAEINFEKGQTCGS-NVSYAYFTSFVFLS 1553

Human  1748 FLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPP 1812
            ..:::|:::|||::||...|.:|: .|.....:.|..||..:||.||..|.:|::.:....:.||
 Worm  1554 SFLMLNLFVAVIMDNFDYLTRDSS-ILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPP 1617

Human  1813 LLIAK--PNKV---QLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANP 1872
            :...|  |.::   .||.|::|:.....:|....|||..:..|       |::.:..|....|: 
 Worm  1618 VGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESL-------SIKMRPVEEMDEAD- 1674

Human  1873 SKVSYEPITTTLKR 1886
                 |.:..|||:
 Worm  1675 -----EELRLTLKK 1683

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN9ANP_001352465.1 I. {ECO:0000305} 112..410 85/321 (26%)
Ion_trans 125..410 CDD:306908 82/308 (27%)
Na_trans_cytopl 488..681 CDD:314757 21/193 (11%)
II. {ECO:0000305} 726..989 90/275 (33%)
Ion_trans 743..956 CDD:306908 74/223 (33%)
Na_trans_assoc 982..1187 CDD:310839 22/205 (11%)
III. {ECO:0000305} 1180..1488 99/321 (31%)
Ion_trans 1191..1466 CDD:306908 93/288 (32%)
Na_channel_gate 1458..1510 CDD:240441 9/53 (17%)
IV. {ECO:0000305} 1497..1795 101/307 (33%)
Ion_trans 1514..1770 CDD:306908 86/265 (32%)
GPHH 1774..1837 CDD:318993 18/68 (26%)
unc-2NP_001355464.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.