DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN9A and egl-19

DIOPT Version :8

Sequence 1:NP_001352465.1 Gene:SCN9A / 6335 HGNCID:10597 Length:1988 Species:Homo sapiens
Sequence 2:NP_001023079.1 Gene:egl-19 / 177513 WormBaseID:WBGene00001187 Length:1877 Species:Caenorhabditis elegans

Alignment Length:1988 Identity:487/1989 (24%)
Similarity:831/1989 (42%) Gaps:578/1989 (29%)


Human    32 SKEPKEEKKDDDEE-----------APKPSSDLEAGKQLPFIYGDIPPGMVSEPLEDLDPYYADK 85
            |.|.:|:...|::|           |...||..:|.|:.|         ...:||         :
 Worm    10 SGEDEEQAAADEQERTDLWQQTLQAAVAASSSQDATKKRP---------AQRKPL---------R 56

Human    86 KTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMNNP-- 148
            :|.:|....:         :|..||..:|:|::.|.|:....|..||:..|..|||.:.:..|  
 Worm    57 QTNVVERSER---------SLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYP 112

Human   149 ---PDWTKN-----VEYTFTGIYTFESLVKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFV 205
               .|: ||     :||.|..::|.|.::||:|.||......:||:.||.|||:::|...::..:
 Worm   113 AQDSDY-KNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTIL 176

Human   206 NL-----GNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQ 265
            :.     .:|.|||.|||||.|:.:|.:|.|:.::.|:::::..|..:.:|.:|.:.::|:|||:
 Worm   177 SKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLE 241

Human   266 LFMGNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSG--QCPEGY 328
            ||.|.|...|          ::.....|              ..||...||..|:..  :|....
 Worm   242 LFCGKLHSTC----------IDPATGQL--------------AQKDPTPCGTDTEGSAFKCQPSD 282

Human   329 TCVKIG-----------RNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQQTLRAAGKTY-MIF 381
            :...:|           ..|:.|.|:||.|..|.|.:|:.::.:.|.::......|.|:.: .|:
 Worm   283 SLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIY 347

Human   382 FVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQKELEFQQMLDRLKKEQEEAEAIAAAAAE 446
            ||.::.||||:::||:|.|::                         ....||:|:|         
 Worm   348 FVTLVILGSFFVLNLVLGVLS-------------------------GEFSKEREKA--------- 378

Human   447 YTSIRRSRIMGLSESSSETSKLSSKSAKERRNRRKKKNQKKLSSGEEKGDAEKLSKSESEDSIRR 511
                   |..||.:...|..:|..                     :.||..:.::::|..:.:  
 Worm   379 -------RARGLFQKFREKQQLEE---------------------DLKGYLDWITQAEDIEPV-- 413

Human   512 KSFHLGVEGHRRAHEKRLSTPNQSPLSIRGSLFSARRSSRTSLFSFKGRGRDIGSETEFADDEHS 576
                                                                  :|.|..|:.  
 Worm   414 ------------------------------------------------------NEDEQEDEP-- 422

Human   577 IFGDNESRRGSLFVPHRPQERRSSNISQASRSPPMLPVNGKMHSAVDCNGVVSLVDGRSALMLPN 641
                                                              |...|.|..|     
 Worm   423 --------------------------------------------------VAQTVVGEEA----- 432

Human   642 GQLLPEVIIDKATSDDSGTTNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEES 706
                          |:.|                 |:.:.|        .|.|.....::.||:.
 Worm   433 --------------DEEG-----------------EERVED--------VRPSKWAARMKRLEKL 458

Human   707 RQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEE 771
            .::|     |.|.:.|:.:.:.||:                  :.:.::||||.:..||:..:|.
 Worm   459 NRRC-----RRACRRLVKSQTFYWL------------------VILLVLLNTLVLTSEHYGQSEW 500

Human   772 FKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVE-----GL 831
            ..:...:.||.|..:|:.||:||:.::....|....:|.||..:|..|::|..|...:     |:
 Worm   501 LDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGV 565

Human   832 SVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECV 896
            |||||.||||:||:.|.|.:|..|:..:.||:.::.:|.|:|.:.:.|||::|||:||..:    
 Worm   566 SVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKF---- 626

Human   897 CKINDDCTLPRWHMNDFFHSFLIVFRVLCGE-WIETMWDCME------VAGQAMCLIVYMMVMVI 954
             ..|.....||.:.:.|..:.|.||::|.|| |...|:..:|      ..|..:| |.|:::.:.
 Worm   627 -NFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVC-IYYIVLFIC 689

Human   955 GNLVVLNLFLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPK 1019
            ||.::||:|||:.:     |||.      ||::|                               
 Worm   690 GNYILLNVFLAIAV-----DNLA------DADSL------------------------------- 712

Human  1020 ISREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFIHNPS 1084
                      .|.:||                  :|:.:|.|          ||.:.:.      
 Worm   713 ----------TNAEKE------------------EEQQEIEG----------EDEEFEE------ 733

Human  1085 LTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEEAEAEPMNSD 1149
                     ||.:.|....:|  .:.|.|.:..|..|.|....::...|:|      :|..:   
 Worm   734 ---------GEDEGEEHGMDE--PEGDEEMTSARPRRMSEVPAASTVKPIP------KASSL--- 778

Human  1150 EPEACFTDGCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVLMILLSSGALAFEDI 1214
                         |.....|          :.|..|..:|.||:|.:.::..||:||..||.|| 
 Worm   779 -------------FILSHTN----------SFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAED- 819

Human  1215 YIERKKTIKIILEYADKIFTYIFILEMLLKWIAYG---YK-TYFTNAWCWLDFLIVDVSLVTLVA 1275
            .::...|..:||.|.|..||.:|.:|:.||.|.:|   :| ::..||:..||.|:|.|||.:.|.
 Worm   820 PLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVL 884

Human  1276 NTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGV 1340
            .|   ..:..:|.||.||.||||||::|.:|::.||..:|.|:.:|.|::||..:...:|:|:||
 Worm   885 RT---DAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGV 946

Human  1341 NLFAGKFYEC---------------INTTDGSRFPASQVPNRSECFALMNVSQNVRWKNLKVNFD 1390
            .||.|.|:.|               |:..||.       |.:.       ||:...|.|...|||
 Worm   947 QLFKGTFFLCNDLSKMTEAECRGEYIHYEDGD-------PTKP-------VSKKRVWSNNDFNFD 997

Human  1391 NVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTLNLFIGV 1455
            |||...:||..|:||:||..::|.|:||...||.|.:.....:.::|:.|||..:||.:|:|:|.
 Worm   998 NVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGF 1062

Human  1456 IIDNF-NQQKKKLGGQDIFMTEEQKKYYN-AMKKLGSKKPQKPIPRPGNKIQGCIFDLVTNQAFD 1518
            :|..| |:.:::.  ::..:.:.|:|... |:|   :|..::.|||  |::|..::..||::||:
 Worm  1063 VIVTFQNEGEREY--ENCELDKNQRKCIEFALK---AKPHRRYIPR--NRLQYRVWWFVTSRAFE 1120

Human  1519 ISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTGECVLKLISLR-HYYFTVGWNIFD 1582
            ..|.::|.:|.|::..:....|:...:.|...|::|..:|..|.|||:::|. ..|.:..||:||
 Worm  1121 YVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFD 1185

Human  1583 FVVVIISIVGMFLADLIE--TYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALF 1645
            .:||:.|.:.:....|..  |..:|...|   ||.|:.|:::|:...:||||||:..|.|..||.
 Worm  1186 LLVVVGSFIDITYGKLNPGGTNLISINFF---RLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALP 1247

Human  1646 NIGLLLFLVMFIYAIFGMSNFAYVKKED--GINDMFNFETFGNSMICLFQITTSAGWDGLLAPIL 1708
            .:.||:.|:.||||:.||..|..|..:|  .|:...||.:|..:::.||:..|...|..::....
 Worm  1248 YVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCS 1312

Human  1709 NSKPPDCDPKK--VHPGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEEST 1771
            :.:...|||..  .|.|...|..||| :....||:|:.::...:|:|:::|||::||...|.: .
 Worm  1313 DREDVRCDPMSDDYHKGGLNESRCGN-NFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRD-W 1375

Human  1772 EPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAK--PNKV---QLIAMDLPMV 1831
            ..|.....|.|..:|.::||||...|:...:......:.|||...|  |:::   :|::|::|:.
 Worm  1376 SILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLN 1440

Human  1832 SGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKR---------- 1886
            |...:.....|||..:         .:|:...|.....||      |.:.:.:||          
 Worm  1441 SDGTVCFNATLFALVR---------TNLKIYTEGNIDEAN------EQLRSAIKRIWKRTHKDLL 1490

Human  1887 --------KQEDVS-----AT-VIQRAYRRYRLRQNVK 1910
                    |::||:     || :||..:||::.|:.::
 Worm  1491 DEVVPPAGKEDDVTVGKFYATFLIQDYFRRFKKRKEME 1528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN9ANP_001352465.1 I. {ECO:0000305} 112..410 90/327 (28%)
Ion_trans 125..410 CDD:306908 86/314 (27%)
Na_trans_cytopl 488..681 CDD:314757 13/193 (7%)
II. {ECO:0000305} 726..989 84/275 (31%)
Ion_trans 743..956 CDD:306908 70/225 (31%)
Na_trans_assoc 982..1187 CDD:310839 27/205 (13%)
III. {ECO:0000305} 1180..1488 113/329 (34%)
Ion_trans 1191..1466 CDD:306908 106/295 (36%)
Na_channel_gate 1458..1510 CDD:240441 12/54 (22%)
IV. {ECO:0000305} 1497..1795 98/305 (32%)
Ion_trans 1514..1770 CDD:306908 83/263 (32%)
GPHH 1774..1837 CDD:318993 18/68 (26%)
egl-19NP_001023079.1 Ion_trans 105..379 CDD:278921 83/340 (24%)
Ion_trans 493..714 CDD:278921 78/279 (28%)
Ion_trans 815..1074 CDD:278921 99/277 (36%)
Ion_trans 1134..1376 CDD:278921 77/247 (31%)
GPHH 1384..1447 CDD:293510 17/63 (27%)
Ca_chan_IQ 1449..1521 CDD:285917 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.